Trim6 (tripartite motif containing 6)

Advanced Search (OLGA)

Gene: Trim6 (tripartite motif containing 6) Rattus norvegicus

Analyze

Symbol:

Trim6

Name:

tripartite motif containing 6

RGD ID:

1310896

Description:

Predicted to enable several functions, including protein homodimerization activity; protein tyrosine kinase binding activity; and ubiquitin protein ligase activity. Predicted to be involved in several processes, including positive regulation of protein phosphorylation; regulation of gene expression; and response to virus. Predicted to be located in nucleus. Predicted to be active in cytosol and nucleoplasm. Orthologous to human TRIM6 (tripartite motif containing 6); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC293294; tripartite motif protein 6; tripartite motif-containing 6; tripartite motif-containing protein 6

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TRIM6 (tripartite motif containing 6)	RGD	RGD
Mus musculus (house mouse):	Trim6 (tripartite motif-containing 6)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Trim6 (tripartite motif containing 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TRIM6 (tripartite motif containing 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TRIM6 (tripartite motif containing 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Trim6 (tripartite motif containing 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TRIM6 (tripartite motif containing 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Trim6 (tripartite motif containing 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TRIM5 (tripartite motif containing 5)	HGNC	Treefam
Alliance orthologs ³
Homo sapiens (human):	TRIM6 (tripartite motif containing 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Trim6 (tripartite motif-containing 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zgc:194990	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Danio rerio (zebrafish):	si:dkey-219e21.2	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Danio rerio (zebrafish):	si:dkey-18p12.4	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Danio rerio (zebrafish):	si:ch211-114c12.5	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Danio rerio (zebrafish):	si:ch73-364h19.2	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Danio rerio (zebrafish):	btr31 (bloodthirsty-related gene family, member 31)	Alliance	DIOPT (Ensembl Compara\|SonicParanoid)
Danio rerio (zebrafish):	si:ch211-120g10.1	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Caenorhabditis elegans (roundworm):	B0281.8	Alliance	DIOPT (Ensembl Compara\|InParanoid)
Caenorhabditis elegans (roundworm):	ZK1240.5	Alliance	DIOPT (Ensembl Compara\|InParanoid)
Caenorhabditis elegans (roundworm):	ZK1240.9	Alliance	DIOPT (Ensembl Compara\|InParanoid)
Caenorhabditis elegans (roundworm):	nhl-3	Alliance	DIOPT (Ensembl Compara\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ZK1240.8	Alliance	DIOPT (Ensembl Compara\|InParanoid)
Caenorhabditis elegans (roundworm):	ZK1240.3	Alliance	DIOPT (Ensembl Compara\|InParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	168,095,619 - 168,108,809 (+)	NCBI		GRCr8
mRatBN7.2	1	158,683,746 - 158,696,936 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	158,683,746 - 158,696,914 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	166,671,350 - 166,684,551 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	173,851,364 - 173,864,566 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	166,744,204 - 166,757,392 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	169,410,084 - 169,423,305 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	169,410,115 - 169,423,283 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	175,550,133 - 175,563,346 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	162,059,220 - 162,094,672 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	162,180,654 - 162,187,805 (+)	NCBI
Celera	1	156,680,750 - 156,687,600 (+)	NCBI		Celera
Cytogenetic Map	1	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,4-dichloroaniline (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

acetamide (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (EXP,ISO)

calcitriol (ISO)

CGP 52608 (ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

choline (ISO)

CU-O LINKAGE (ISO)

cyclosporin A (ISO)

cytarabine (ISO)

DDE (ISO)

decabromodiphenyl ether (EXP)

dexamethasone (ISO)

dichloroacetic acid (ISO)

diethyl maleate (EXP)

dimethylarsinic acid (ISO)

diuron (ISO)

dorsomorphin (ISO)

entinostat (ISO)

folic acid (ISO)

genistein (ISO)

gentamycin (EXP)

glafenine (EXP)

indometacin (ISO)

L-methionine (ISO)

lithium chloride (ISO)

methylarsonic acid (ISO)

methylmercury chloride (ISO)

mono(2-ethylhexyl) phthalate (ISO)

Monobutylphthalate (ISO)

nickel atom (ISO)

oxaliplatin (EXP)

panobinostat (ISO)

paracetamol (EXP)

perfluorooctanoic acid (EXP)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

potassium dichromate (ISO)

propiconazole (ISO)

rotenone (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium dodecyl sulfate (ISO)

succimer (ISO)

temozolomide (ISO)

testosterone (EXP)

topotecan (EXP)

trichostatin A (ISO)

Triptolide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antiviral innate immune response (ISO)

biological_process (ND)

cellular response to interferon-beta (ISO)

cellular response to virus (ISO)

free ubiquitin chain polymerization (ISO)

innate immune response (IBA)

negative regulation of DNA-templated transcription (ISO)

negative regulation of gene expression (ISO)

negative regulation of stem cell differentiation (ISO)

negative regulation of viral genome replication (ISO)

positive regulation of autophagy (IBA)

positive regulation of canonical NF-kappaB signal transduction (IBA)

positive regulation of cytokine production involved in immune response (ISO)

positive regulation of defense response to virus by host (ISO)

positive regulation of gene expression (ISO)

positive regulation of peptidyl-serine phosphorylation (IEA,ISO)

positive regulation of peptidyl-threonine phosphorylation (IEA,ISO)

positive regulation of type I interferon-mediated signaling pathway (ISO)

protein K48-linked ubiquitination (ISO)

protein polyubiquitination (IBA,ISO)

regulation of non-canonical NF-kappaB signal transduction (ISO)

regulation of protein localization (IBA)

regulation of protein stability (ISO)

regulation of viral entry into host cell (IBA)

response to lipopolysaccharide (ISO)

Cellular Component

cytoplasm (IBA,ISO)

cytosol (IBA,ISO)

nucleoplasm (IBA)

nucleus (ISO)

Molecular Function

DNA-binding transcription factor binding (ISO)

identical protein binding (ISO)

metal ion binding (IEA)

protein binding (ISO)

protein homodimerization activity (IBA)

protein kinase binding (IBA,ISO)

protein tyrosine kinase binding (ISO)

protein-macromolecule adaptor activity (ISO)

ubiquitin protein ligase activity (IBA,ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:11331580	PMID:17156811	PMID:22328504	PMID:24882218	PMID:25127057

Genomics

Comparative Map Data

Trim6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	168,095,619 - 168,108,809 (+)	NCBI		GRCr8
mRatBN7.2	1	158,683,746 - 158,696,936 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	158,683,746 - 158,696,914 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	166,671,350 - 166,684,551 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	173,851,364 - 173,864,566 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	166,744,204 - 166,757,392 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	169,410,084 - 169,423,305 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	169,410,115 - 169,423,283 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	175,550,133 - 175,563,346 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	162,059,220 - 162,094,672 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	162,180,654 - 162,187,805 (+)	NCBI
Celera	1	156,680,750 - 156,687,600 (+)	NCBI		Celera
Cytogenetic Map	1	q32	NCBI

TRIM6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	5,596,111 - 5,612,952 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	5,596,109 - 5,612,958 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	5,617,341 - 5,634,182 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	5,573,923 - 5,590,764 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	5,573,922 - 5,590,764	NCBI
Celera	11	5,735,961 - 5,753,014 (+)	NCBI		Celera
Cytogenetic Map	11	p15.4	NCBI
HuRef	11	5,275,183 - 5,292,762 (+)	NCBI		HuRef
CHM1_1	11	5,616,290 - 5,633,137 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	5,655,518 - 5,672,393 (+)	NCBI		T2T-CHM13v2.0

Trim6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	103,868,002 - 103,884,359 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	103,868,000 - 103,884,359 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	104,218,795 - 104,235,152 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	104,218,793 - 104,235,152 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	111,367,309 - 111,383,666 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	94,018,892 - 94,035,354 (+)	NCBI		MGSCv36	mm8
MGSCv36	7	104,092,637 - 104,108,973 (+)	NCBI		MGSCv36	mm8
Celera	7	104,604,665 - 104,619,682 (+)	NCBI		Celera
Cytogenetic Map	7	E3	NCBI
cM Map	7	55.55	NCBI

Trim6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955414	21,481,129 - 21,514,548 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955414	21,495,593 - 21,513,703 (+)	NCBI	ChiLan1.0	ChiLan1.0

TRIM6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	8,034,820 - 8,052,099 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	7,992,489 - 8,009,781 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	5,731,256 - 5,748,057 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	5,412,952 - 5,460,537 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	5,413,491 - 5,460,532 (+)	Ensembl	panpan1.1		panPan2

TRIM6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	21	28,595,887 - 28,611,562 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	21	28,595,448 - 28,611,124 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	21	28,383,550 - 28,390,775 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	21	29,419,425 - 29,434,660 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	21	29,419,208 - 29,434,659 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	21	28,735,956 - 28,743,169 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	21	28,941,372 - 28,948,584 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	21	29,076,932 - 29,084,154 (+)	NCBI		UU_Cfam_GSD_1.0

Trim6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	57,485,230 - 57,493,226 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004937097	24,911 - 31,681 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004937097	23,695 - 31,673 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TRIM6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	61,136,690 - 61,147,911 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666043	64,854,397 - 64,870,606 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Trim6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624817	7,045,228 - 7,053,525 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624817	7,029,104 - 7,053,447 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Trim6
94 total Variants

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61442	Strs1	Sensitivity to stroke QTL 1	7.4		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	1	121767634	166767634	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
1598866	Bp287	Blood pressure QTL 287	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121006655	166006655	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	123350408	182418476	Rat
70160	Bw18	Body weight QTL 18	5.7		body mass (VT:0001259)	body weight (CMO:0000012)	1	144267353	196383668	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
631199	Cm23	Cardiac mass QTL 23	4.6	0.0004	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	115585465	172949803	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	151162512	201278233	Rat
1598850	Bp297	Blood pressure QTL 297	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121006655	166006655	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	151162512	201278233	Rat
4889428	Stresp24	Stress response QTL 24		0.05	heart pumping trait (VT:2000009)	absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162)	1	155866514	200866514	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
61343	Bp28	Blood pressure QTL 28			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	151646613	196646613	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	90508614	173018436	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	90508614	180359386	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	158633083	203633083	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	144017057	197814409	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	100357752	183970443	Rat
2303622	Vencon6	Ventilatory control QTL 6		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	1	154561505	199561505	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	149448574	221264292	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
631202	Gluco13	Glucose level QTL 13		0.0001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	131763437	159756369	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118944897	199050459	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	115540693	185145286	Rat
631206	Niddm40	Non-insulin dependent diabetes mellitus QTL 40			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	136745990	163747690	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	94494440	181830018	Rat
9685799	Bp375	Blood pressure QTL 375			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	170611501	Rat
2293140	Bp313	Blood pressure QTL 313			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121833674	166833674	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
9685802	Bp376	Blood pressure QTL 376			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	126540680	171540680	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	123350408	182418476	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
634315	Niddm45	Non-insulin dependent diabetes mellitus QTL 45	7.16		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	144267916	172949660	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
61379	Bp44	Blood pressure QTL 44	19.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	144267916	174133260	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94494440	172949803	Rat
2313060	Bss71	Bone structure and strength QTL 71	2.6	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	1	118944747	163944747	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	156677124	218753816	Rat
6893347	Bw98	Body weight QTL 98	0.2	0.53	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
724550	Thym3	Thymus enlargement QTL 3	7.82	0.001	thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	136829932	181829932	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
71118	Thym1	Thymus enlargement QTL 1	10.17	0.001	thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	136829932	181829932	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	136830018	181830018	Rat
6893361	Bw104	Body weight QTL 104	0.59	0.27	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
738006	Anxrr14	Anxiety related response QTL 14	4	0.00035	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
1558645	Bw55	Body weight QTL 55	3.2	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
1582204	Livw1	Liver weight QTL 1	3.6	0.0003	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	1	155422851	172949803	Rat
634348	Bp138	Blood pressure QTL 138			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	168883176	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
738028	Anxrr12	Anxiety related response QTL 12	4.9	0.00001	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	201278233	Rat
1354618	Kidm15	Kidney mass QTL 15	5		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	1	156677124	201278233	Rat
631654	Bp107	Blood pressure QTL 107			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	170611501	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350408	181759564	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350581	201284552	Rat
631548	Bp88	Blood pressure QTL 88	5	0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	156677124	176484451	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	123350408	182418476	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	201278233	Rat

Markers in Region

RH130109

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	158,696,687 - 158,696,866 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	169,423,057 - 169,423,235	NCBI	Rnor6.0
Rnor_5.0	1	175,563,098 - 175,563,276	UniSTS	Rnor5.0
RGSC_v3.4	1	162,072,707 - 162,072,885	UniSTS	RGSC3.4
Celera	1	156,687,352 - 156,687,530	UniSTS
RH 3.4 Map	1	1306.0	UniSTS
Cytogenetic Map	1	q32	UniSTS

BI280655

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	158,718,469 - 158,718,595 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	169,444,837 - 169,444,962	NCBI	Rnor6.0
Rnor_5.0	1	175,584,877 - 175,585,002	UniSTS	Rnor5.0
RGSC_v3.4	1	162,094,486 - 162,094,611	UniSTS	RGSC3.4
Celera	1	156,709,004 - 156,709,129	UniSTS
RH 3.4 Map	1	1300.2	UniSTS
Cytogenetic Map	1	q32	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	48	105	91	90	59	25	59	6	216	96	85	44	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001170461	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008759707	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017588978	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC112864	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC113720	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CV121315	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM029933	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000023043 ⟹ ENSRNOP00000023043

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	158,683,746 - 158,696,914 (+)	Ensembl
Rnor_6.0 Ensembl	1	169,410,115 - 169,423,283 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104729 ⟹ ENSRNOP00000084922

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	158,690,138 - 158,696,914 (+)	Ensembl

RefSeq Acc Id:

NM_001170461 ⟹ NP_001163932

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	168,095,619 - 168,108,809 (+)	NCBI
mRatBN7.2	1	158,683,746 - 158,696,936 (+)	NCBI
Rnor_6.0	1	169,410,115 - 169,423,305 (+)	NCBI
Rnor_5.0	1	175,550,133 - 175,563,346 (+)	NCBI
Celera	1	156,680,750 - 156,687,600 (+)	NCBI

Sequence:

show sequence

CGCACTGATCCAGGCCACGGATTCCAGGATTCTATAAGCAGACCTGGAAAGATAGGAGACAAGA
GAGTGACTACAATGACTTCAGCAGTCCTGGTGGACATCCGAGATGAAGTCACTTGCCCTATCTG
CTTGGAGCTCCTGACAGAACCCCTGAGCATAGATTGCGGTCATAGCTTCTGCCAGGCCTGCATC
ATAGGAAACAGTGATAATTCAGTGCTCAACCCAGAAGGGAAGAGCAGCTGTCCTGTGTGCCGGA
CCGTCTACCAGCCTGGGAGCCTCCGTCCTAACCGGCACCTGGCCGCCATAGTGAAAAGGCTCAG
AGAAGTCGTGTTAGGCCCTGGAAAACAGCTCGAGGTCATTTTTTGTGCGCTTCATGGAGAGAAA
CTTCAACTTTTTTGCAAGGAGGATGGGAAGTTAATTTGCTGGCTTTGTGAGCGATCTCTGGAGC
ACCGTGGTCATCACACATTCCTCATGGAGGAGGTAGCACAGGAGTACCAGGACATGTTCCAGGA
GTCTCTGAAGAAGCTGAGGAGGGAGCAGCAGGAAGCCGAGAAGCTAAAAGCTCTTATCCAAGAG
AAGAGGGAATCCTGGAAGAGTCAGGTGGAGCCTGAGAGACACCGGATCCAGACAGAGTTTAATC
AGCTCCGAAGCATCCTGGACAGGGAGGAGCAGCGGGAACTGAAGAAACTGGAAGTGGAAGAGAG
GAAGGGGCTGAGCGTCATAGAAAAGGCCGAGGGTGACCTGATCCACCAGAGCCAGGCACTAAAA
GACCTCATCTCAGACCTGGAGCACCGGTGCCGGGGGTCCACAGTGGAACTGTTGCAGGATGTGG
GTGACGTCACAAAAAGGAGTGAGTTCTGGACCTTGAAGAAGCCCCAAGCTCTCCCCACCAAGCT
GAAAAGTTTGTTTCGAGCCCCGGATCTGAAGAAGATGCTGCGAGTCTTTAGAGAGCTGACAGAC
GTCCAAAGCTACTGGGTGGACGTGACTCTGAATCCACAGACGGCTAATTTAAATCTTGTCCTGT
CGAAAAACCGGAGACAGGTGAGGTTTGTGGGTGCCAAGCTGTCGGAGCCGTCTAGTCTGGAAGA
ACATTATGACTGTAGTGTCCTGGGTTCTCAGCACTTCTCCTCAGGCAAATACTACTGGGAAGTG
GATGTGACCAAGAAGACGGCGTGGATCTTGGGTGTATGCAGTACCCCTGTGGAACCCATGTTCT
CCTTCAGCCAGTACTCCAGTAAGCAGGGTGCCTACTCTCGGTATCAGCCACAGAGTGGATACTG
GGTGATAGGTTTGCAGCGTAAGCACGAGTACAGAGCCTATGAGGACTCCTCCCCATCCCTGCTC
CTCTCCATGACGGTGCCACCTCGACGCATAGGGGTTTTCTTAGACTATGAGGCTGGCACGGTCT
CCTTTTATAATGTCACAAACCATGGCTTGCCCATCTACACCTTCTCCAAGTATTACTTCCCTAC
TGCCCTTTGTCCGTATTTTAATCCCTGCAGCTGTGTAGTCCCGATGACTCTGCGGCGCCCAACT
TCCTGAGGCCTGCTGCCTCTTCCCATAACGAAGCAGATTCCTTCAAACACATTACTTTCCTCTT
CGAGCCTCTGTTCTCCTAGTAGAACACTGCCCATTGCTGAAGTGATCACTCTTGACCCATCTCA
TAGGAAAGTAGTGTTTTGGGTTGGTTTTTGTTTGTTTGTTTTGTTTTGTTTTTTTGAGGTAGGA
TTTCTGGAACTCTCTCTCTAGGGCAGGCTGACTTTGAACTCAGAGAGATCCAATTACCTCCCTT
CTGAATGCCAGGGTTGAAGTCATGTGACACCGTCCCAGTTTTGTGATTGAGAAAGTAACTGAAA
ATTGATCCAGAGTCCTAATGCACATGCCCATACTTGGCTGCGATTTTGTTTTAATGTTAAGATA
TAGGCCGCAAAAATAGTCCAAGCTGGCCACAGACTCCGTCCTTCTGCCTCACCTCCCAAATACT
GAGTATAGGTTTATCTGACAACACCTGGCTAAGCATGATATTTGATGTGTATGGTCAAATGTAA
AAAATTCTCTATAAATTAGATGGGAGGTTTTTTGGTTTGGTTGGTTTTTTTGTTTGTTTGTTTG
TTTGTTTTTGTTTTGTTTTTTGGGTTCTTTTGTAACTATTGAATTTAATAGATTTTTTTCCCTA
TAGTTATTTAGAGAATTGTGTACCCTTTTTATTCTGCTCCTGGGTCAGCTACACTGAGTAGTCT
AGGTTGTCAAGTTCACCACTGATTCCTGAAGTACATGTGTTACATTCAGTACTTCTTTTTTTTT
CTGACTCTAGGTTCGGTTTTCATCGATCTTTCTAAACAAAACTACCTCTAACTTTGCATTCTCG
TGCTTTCTGGTAATATATAAAAAAGAAATTATGGGCAAGGGATTATATGTATATTTAGGATTAT
AATAAAATAATAAAAATCGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001163932	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000023043.5
	ENSRNOP00000084922.1

RefSeq Acc Id:

NP_001163932 ⟸ NM_001170461

- UniProtKB:

D4A3L4 (UniProtKB/TrEMBL), A0A8I5ZYZ0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTSAVLVDIRDEVTCPICLELLTEPLSIDCGHSFCQACIIGNSDNSVLNPEGKSSCPVCRTVYQ
PGSLRPNRHLAAIVKRLREVVLGPGKQLEVIFCALHGEKLQLFCKEDGKLICWLCERSLEHRGH
HTFLMEEVAQEYQDMFQESLKKLRREQQEAEKLKALIQEKRESWKSQVEPERHRIQTEFNQLRS
ILDREEQRELKKLEVEERKGLSVIEKAEGDLIHQSQALKDLISDLEHRCRGSTVELLQDVGDVT
KRSEFWTLKKPQALPTKLKSLFRAPDLKKMLRVFRELTDVQSYWVDVTLNPQTANLNLVLSKNR
RQVRFVGAKLSEPSSLEEHYDCSVLGSQHFSSGKYYWEVDVTKKTAWILGVCSTPVEPMFSFSQ
YSSKQGAYSRYQPQSGYWVIGLQRKHEYRAYEDSSPSLLLSMTVPPRRIGVFLDYEAGTVSFYN
VTNHGLPIYTFSKYYFPTALCPYFNPCSCVVPMTLRRPTS

hide sequence

Ensembl Acc Id:

ENSRNOP00000023043 ⟸ ENSRNOT00000023043

Ensembl Acc Id:

ENSRNOP00000084922 ⟸ ENSRNOT00000104729

Protein Domains

B box-type B30.2/SPRY RING-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A3L4-F1-model_v2	AlphaFold	D4A3L4	1-488	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310896	AgrOrtholog
BioCyc Gene	G2FUF-58096	BioCyc
Ensembl Genes	ENSRNOG00000017147	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000023043.7	UniProtKB/TrEMBL
	ENSRNOT00000104729.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.120.920	UniProtKB/TrEMBL
	3.30.40.10	UniProtKB/TrEMBL
	Classic Zinc Finger	UniProtKB/TrEMBL
InterPro	B30.2/SPRY_sf	UniProtKB/TrEMBL
	B302	UniProtKB/TrEMBL
	Butyrophylin	UniProtKB/TrEMBL
	ConA-like_dom	UniProtKB/TrEMBL
	PRY	UniProtKB/TrEMBL
	PRY/SPRY_TRIM6	UniProtKB/TrEMBL
	SPRY_rcpt	UniProtKB/TrEMBL
	TRIM/RBCC	UniProtKB/TrEMBL
	Znf-RING_LisH	UniProtKB/TrEMBL
	Znf_B-box	UniProtKB/TrEMBL
	Znf_RING	UniProtKB/TrEMBL
	Znf_RING/FYVE/PHD	UniProtKB/TrEMBL
	Znf_RING_CS	UniProtKB/TrEMBL
KEGG Report	rno:293294	UniProtKB/TrEMBL
NCBI Gene	293294	ENTREZGENE
PANTHER	E3 UBIQUITIN-PROTEIN LIGASE TRIM	UniProtKB/TrEMBL
	TRIPARTITE MOTIF-CONTAINING PROTEIN 6	UniProtKB/TrEMBL
Pfam	PRY	UniProtKB/TrEMBL
	SPRY	UniProtKB/TrEMBL
	zf-B_box	UniProtKB/TrEMBL
	zf-RING_UBOX	UniProtKB/TrEMBL
PhenoGen	Trim6	PhenoGen
PRINTS	BUTYPHLNCDUF	UniProtKB/TrEMBL
PROSITE	B302_SPRY	UniProtKB/TrEMBL
	ZF_BBOX	UniProtKB/TrEMBL
	ZF_RING_1	UniProtKB/TrEMBL
	ZF_RING_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000017147	RatGTEx
SMART	BBOX	UniProtKB/TrEMBL
	PRY	UniProtKB/TrEMBL
	RING	UniProtKB/TrEMBL
	SPRY	UniProtKB/TrEMBL
Superfamily-SCOP	B-box zinc-binding domain	UniProtKB/TrEMBL
	ConA_like_lec_gl	UniProtKB/TrEMBL
	RING/U-box	UniProtKB/TrEMBL
UniProt	A0A8I5ZYZ0	ENTREZGENE, UniProtKB/TrEMBL
	D4A3L4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-02-15	Trim6	tripartite motif containing 6	Trim34	tripartite motif containing 34	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-16	Trim34	tripartite motif containing 34	Trim6	tripartite motif-containing 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-31	Trim6	tripartite motif-containing 6	Trim6	tripartite motif protein 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-04	Trim6	tripartite motif protein 6	Trim34_predicted	tripartite motif protein 34 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-12	Trim34_predicted	tripartite motif protein 34 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message