Ptgir (prostaglandin I2 receptor)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ptgir (prostaglandin I2 receptor) Rattus norvegicus

Analyze

Symbol:

Ptgir

Name:

prostaglandin I2 receptor

RGD ID:

1310890

Description:

Predicted to enable prostacyclin receptor activity. Predicted to be involved in several processes, including adenylate cyclase-activating G protein-coupled receptor signaling pathway; negative regulation of platelet-derived growth factor receptor signaling pathway; and negative regulation of smooth muscle cell proliferation. Predicted to act upstream of or within response to lipopolysaccharide. Predicted to be located in cytosol. Predicted to be active in plasma membrane. Orthologous to human PTGIR (prostaglandin I2 receptor); PARTICIPATES IN eicosanoid signaling pathway; prostaglandin I2 signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrobenzenesulfonic acid; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC292661; PGI receptor; PGI2 receptor; prostacyclin receptor; prostaglandin I receptor (IP); prostaglandin I2 (prostacyclin) receptor; prostaglandin I2 (prostacyclin) receptor (IP); prostanoid IP receptor

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PTGIR (prostaglandin I2 receptor)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ptgir (prostaglandin I receptor (IP))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ptgir (prostaglandin I2 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PTGIR (prostaglandin I2 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PTGIR (prostaglandin I2 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ptgir (prostaglandin I2 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PTGIR (prostaglandin I2 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PTGIR (prostaglandin I2 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ptgir (prostaglandin I2 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RFLNB (refilin B)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	PTGIR (prostaglandin I2 receptor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ptgir (prostaglandin I receptor (IP))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ptgir (prostaglandin I2 receptor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG7497	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ptgir	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	77,579,596 - 77,581,979 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	77,579,596 - 77,581,979 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	82,959,574 - 82,961,958 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	1	91,523,619 - 91,526,003 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	1	84,714,664 - 84,717,048 (+)	NCBI	Rnor_WKY
Rnor_6.0	1	78,833,449 - 78,835,832 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	78,833,157 - 78,837,623 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	80,080,854 - 80,083,237 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	77,234,538 - 77,236,921 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	77,312,476 - 77,315,005 (+)	NCBI
Celera	1	72,064,851 - 72,067,234 (+)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

aspirin-induced respiratory disease (ISO)

genetic disease (ISO)

heart disease (ISO)

long QT syndrome 1 (ISO)

Walker-Warburg syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4,6-trinitrobenzenesulfonic acid (EXP)

3',5'-cyclic AMP (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

acetylsalicylic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

asbestos (ISO)

benzo[a]pyrene (ISO)

beraprost (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

buta-1,3-diene (ISO)

butanal (ISO)

calcium atom (ISO)

calcium(0) (ISO)

cannabidiol (ISO)

capsaicin (ISO)

Carbaprostacyclin (ISO)

carbon nanotube (ISO)

chloroprene (ISO)

choline (ISO)

cicaprost (ISO)

clofibrate (EXP)

Cuprizon (EXP)

dexamethasone (ISO)

dextran sulfate (ISO)

dioxygen (ISO)

endosulfan (EXP)

folic acid (ISO)

gentamycin (EXP)

hypochlorous acid (ISO)

iloprost (ISO)

indometacin (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

mevalonolactone (ISO)

mifepristone (ISO)

N-methyl-4-phenylpyridinium (ISO)

nickel atom (ISO)

Nor-9-carboxy-delta9-THC (ISO)

paracetamol (EXP,ISO)

pentanal (ISO)

propanal (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sotorasib (ISO)

succimer (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trametinib (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating G protein-coupled receptor signaling pathway (IBA,ISO)

G protein-coupled receptor signaling pathway (IEA)

inflammatory response (IBA)

negative regulation of platelet-derived growth factor receptor signaling pathway (ISO)

negative regulation of smooth muscle cell proliferation (IBA,ISO)

positive regulation of cytosolic calcium ion concentration (IBA)

regulation of multicellular organismal process (IEA)

response to lipopolysaccharide (ISO)

Cellular Component

cytosol (ISO)

membrane (IEA)

plasma membrane (IBA,ISO)

Molecular Function

G protein-coupled receptor activity (IEA)

prostacyclin receptor activity (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

eicosanoid signaling pathway (ISO)

prostaglandin I2 signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
5.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:7803522	PMID:15834430	PMID:19696359	PMID:20622039	PMID:20622163	PMID:21549696	PMID:21749934

Genomics

Comparative Map Data

Ptgir
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	77,579,596 - 77,581,979 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	77,579,596 - 77,581,979 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	82,959,574 - 82,961,958 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	1	91,523,619 - 91,526,003 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	1	84,714,664 - 84,717,048 (+)	NCBI	Rnor_WKY
Rnor_6.0	1	78,833,449 - 78,835,832 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	78,833,157 - 78,837,623 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	80,080,854 - 80,083,237 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	77,234,538 - 77,236,921 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	77,312,476 - 77,315,005 (+)	NCBI
Celera	1	72,064,851 - 72,067,234 (+)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

PTGIR
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	46,610,687 - 46,625,089 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	19	46,620,468 - 46,625,089 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	47,123,725 - 47,128,346 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	51,815,565 - 51,820,194 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	51,815,565 - 51,820,194	NCBI
Celera	19	43,927,252 - 43,931,881 (-)	NCBI		Celera
Cytogenetic Map	19	q13.32	NCBI
HuRef	19	43,548,741 - 43,553,370 (-)	NCBI		HuRef
CHM1_1	19	47,125,572 - 47,130,201 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	49,436,301 - 49,450,683 (-)	NCBI		T2T-CHM13v2.0

Ptgir
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	16,640,442 - 16,644,828 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	16,640,415 - 16,644,830 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	16,906,490 - 16,910,905 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	16,906,490 - 16,910,905 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	17,491,839 - 17,496,254 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	16,065,012 - 16,069,427 (+)	NCBI		MGSCv36	mm8
Celera	7	14,112,908 - 14,117,323 (+)	NCBI		Celera
Cytogenetic Map	7	A2	NCBI
cM Map	7	9.15	NCBI

Ptgir
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955574	687,583 - 689,750 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955574	686,156 - 690,126 (-)	NCBI	ChiLan1.0	ChiLan1.0

PTGIR
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	19	54,641,360 - 54,645,906 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	43,613,065 - 43,617,700 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	52,141,822 - 52,146,473 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	52,141,822 - 52,146,473 (-)	Ensembl	panpan1.1		panPan2

PTGIR
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	109,275,198 - 109,279,463 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	109,274,988 - 109,277,584 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	108,754,493 - 108,758,755 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	109,801,203 - 109,805,465 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	1	109,478,359 - 109,480,898 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	109,112,477 - 109,116,738 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	109,981,209 - 109,985,471 (+)	NCBI		UU_Cfam_GSD_1.0

Ptgir
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	18,866,264 - 18,871,516 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936664	487,125 - 489,414 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936664	487,069 - 489,328 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PTGIR
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	52,522,638 - 52,527,345 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	52,522,639 - 52,527,338 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	47,842,083 - 47,847,155 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PTGIR
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	39,977,057 - 39,983,592 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	39,977,864 - 39,980,860 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	19,689,063 - 19,693,721 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ptgir
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	6,948,572 - 6,952,719 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624832	6,948,638 - 6,952,664 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ptgir
10 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	110
Count of miRNA genes:	94
Interacting mature miRNAs:	102
Transcripts:	ENSRNOT00000022461
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	28879780	78430678	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	33449848	78449848	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	33449848	78449848	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	35239598	78430678	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	35239598	78430678	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	45803140	78430678	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	53895117	82174945	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	53895117	82174945	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	72197680	90508767	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium					1							8
Low	3	30	54	38	18	38	7	10	24	35	33	3	7
Below cutoff		13	3	3		3	1	1	50		6		1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001077644	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC127887	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D28966	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000033	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000022461 ⟹ ENSRNOP00000022461

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	77,579,596 - 77,581,979 (+)	Ensembl
Rnor_6.0 Ensembl	1	78,833,157 - 78,837,623 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000100532 ⟹ ENSRNOP00000089168

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	77,579,678 - 77,581,979 (+)	Ensembl

RefSeq Acc Id:

NM_001077644 ⟹ NP_001071112

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	77,579,596 - 77,581,979 (+)	NCBI
Rnor_6.0	1	78,833,449 - 78,835,832 (+)	NCBI
Rnor_5.0	1	80,080,854 - 80,083,237 (+)	NCBI
RGSC_v3.4	1	77,234,538 - 77,236,921 (+)	RGD
Celera	1	72,064,851 - 72,067,234 (+)	RGD

Sequence:

show sequence

CTGGAGAAGACGGAAACAAAAGACAGAAACACACGCACACGGGGAACTGGGAGTTGACTGGCAG
ATCCCAGCTGCCCTGAGGATGGTGGCCAGCGGTGGACGTCCTGATGGTCCCCCTTCTATCACCC
CCGAGAGCCCTCTCATTGTAGGTGGCAGAGAGTGGCAGGGTATGGCAGGTTCTTGCTGGAACAT
CACCTACGTTCAAGACTCGGTAGGACCTGCCACCAGCACCCTGATGTTTGTGGCTGGTGTGGTG
GGCAACGGGCTAGCACTGGGCATCCTGGGTGCCCGACGGAGGTCACACCCATCGGCGTTTGCAG
TGTTGGTCACTGGGCTGGCAGTGACGGATCTGCTGGGCACGTGCTTCTTGAGCCCCGCGGTGTT
TGTGGCCTATGCTCGAAACAGCTCTTTGCTGGGCCTGGCCCACGGTGGGACGATGCTGTGTGAC
ACTTTCGCCTTCGCTATGACTTTCTTCGGCCTGGCCTCCACGCTCATCCTCTTCGCCATGGCTG
TGGAGCGGTGCCTGGCTCTCAGTCATCCCTACCTGTACGCCCAGCTGGACGGGCCCCGCTGTGC
CCGCTTGGCTTTGCCTGCCATCTACGCTTTCTGTTGTCTCTTCTGCTCACTGCCCCTGCTGGGC
CTGGGCGAGCACCAGCAGTATTGTCCCGGGAGCTGGTGCTTCATCCGCATGCGTTCCCCCCAGC
CTGGTGGCTGTGCCTTCTCCCTGGCCTATGCCAGTCTCATGGCCCTGCTGGTGACCTCCATCTT
CTTCTGCAACGGCTCCGTCACTCTCAGCCTCTGTCACATGTACCGCCAACAGAGACGGCACCAT
GGCTCGTTTGTGCCGACCTCTCGGGCACGAGAGGATGAAGTTTACCACCTGATTCTGCTGGCCC
TCATGACAGGCATCATGGCCGTATGCTCCCTGCCTCTCACGATCAGAGGATTCACGCAGGCCAT
CGCCCCAGACAGCAGAGAGATGGGGGACCTCCACGCCTTCCGTTTTAATGCCTTCAACCCCATC
CTGGACCCCTGGGTCTTCATCCTTTTCCGAAAGGCTGTCTTCCAACGCCTCAAGTTCTGGTTGT
GTTGTCTGTGTGCCCGTTCTGTCCATGGGGATCTGCAGACGCCCCTCTCCCGGCCCGTGTCGGG
GAGAAGAGACACACTGGCTCCCGATTCTCTCCAGGCTAAGGAAGGGAACTGGGTGCCCCTGTCA
ACCTGGGGTACGGGGCAGGTGGCACCATTGACTGCTGTGCCTCTGTCTGGTGGTGATGGCTGTT
CTGTGGGAATGCCATCCAAAACAGAGGCTGTGGTTGCCTGCTCCCTCTGCTGATACCTAAGCTG
GTCCTGCTTGCCATCC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001071112	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA06091	(Get FASTA)	NCBI Sequence Viewer
	EDM08294	(Get FASTA)	NCBI Sequence Viewer
	EDM08295	(Get FASTA)	NCBI Sequence Viewer
	P43253	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_001071112 ⟸ NM_001077644

- UniProtKB:

P43253 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MVASGGRPDGPPSITPESPLIVGGREWQGMAGSCWNITYVQDSVGPATSTLMFVAGVVGNGLAL
GILGARRRSHPSAFAVLVTGLAVTDLLGTCFLSPAVFVAYARNSSLLGLAHGGTMLCDTFAFAM
TFFGLASTLILFAMAVERCLALSHPYLYAQLDGPRCARLALPAIYAFCCLFCSLPLLGLGEHQQ
YCPGSWCFIRMRSPQPGGCAFSLAYASLMALLVTSIFFCNGSVTLSLCHMYRQQRRHHGSFVPT
SRAREDEVYHLILLALMTGIMAVCSLPLTIRGFTQAIAPDSREMGDLHAFRFNAFNPILDPWVF
ILFRKAVFQRLKFWLCCLCARSVHGDLQTPLSRPVSGRRDTLAPDSLQAKEGNWVPLSTWGTGQ
VAPLTAVPLSGGDGCSVGMPSKTEAVVACSLC

hide sequence

RefSeq Acc Id:

ENSRNOP00000022461 ⟸ ENSRNOT00000022461

RefSeq Acc Id:

ENSRNOP00000089168 ⟸ ENSRNOT00000100532

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P43253-F1-model_v2	AlphaFold	P43253	1-416	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689744

Promoter ID:

EPDNEW_R268

Type:

initiation region

Name:

Ptgir_1

Description:

prostaglandin I2 receptor

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	78,833,234 - 78,833,294	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310890	AgrOrtholog
BioCyc Gene	G2FUF-60588	BioCyc
Ensembl Genes	ENSRNOG00000016756	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000022461	ENTREZGENE
	ENSRNOP00000022461.2	UniProtKB/Swiss-Prot
	ENSRNOP00000089168.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000022461	ENTREZGENE
	ENSRNOT00000022461.4	UniProtKB/Swiss-Prot
	ENSRNOT00000100532.1	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	Prostanoid_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Prostglndn_IP_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:292661	UniProtKB/Swiss-Prot
NCBI Gene	292661	ENTREZGENE
PANTHER	PTHR11866	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11866:SF7	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/Swiss-Prot
PhenoGen	Ptgir	PhenoGen
PRINTS	PROSTANOIDR	UniProtKB/Swiss-Prot
	PRSTNOIDIPR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6AC54_RAT	UniProtKB/TrEMBL
	P43253	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-08-22	Ptgir	prostaglandin I2 receptor	Ptgir	prostaglandin I2 (prostacyclin) receptor (IP)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-04-23	Ptgir	prostaglandin I2 (prostacyclin) receptor (IP)	Ptgir	prostaglandin I2 (prostacyclin) receptor	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-12-15	Ptgir	prostaglandin I2 (prostacyclin) receptor	Ptgir	prostaglandin I receptor (IP)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Ptgir	prostaglandin I receptor (IP)	Ptgir_predicted	prostaglandin I receptor (IP) (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Ptgir_predicted	prostaglandin I receptor (IP) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - PID (archival)