Advanced Search (OLGA)

Gene: Ifi30 (IFI30, lysosomal thiol reductase) Rattus norvegicus

Analyze

Symbol:

Ifi30

Name:

IFI30, lysosomal thiol reductase

RGD ID:

1310758

Description:

Predicted to enable oxidoreductase activity, acting on a sulfur group of donors. Predicted to be involved in antigen processing and presentation of exogenous peptide antigen via MHC class I. Predicted to act upstream of or within antigen processing and presentation of exogenous peptide antigen via MHC class II; negative regulation of fibroblast proliferation; and protein stabilization. Predicted to be located in cell junction; cytosol; and intracellular membrane-bounded organelle. Predicted to be active in lysosome. Orthologous to human IFI30 (IFI30 lysosomal thiol reductase); PARTICIPATES IN antigen processing and presentation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrobenzenesulfonic acid; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

gamma-interferon-inducible lysosomal thiol reductase; interferon gamma inducible protein 30; LOC290644; MGC124690

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	IFI30 (IFI30 lysosomal thiol reductase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ifi30 (interferon gamma inducible protein 30)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ifi30 (IFI30 lysosomal thiol reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	IFI30 (IFI30 lysosomal thiol reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	IFI30 (IFI30 lysosomal thiol reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ifi30 (IFI30 lysosomal thiol reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	IFI30 (IFI30 lysosomal thiol reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	IFI30 (IFI30 lysosomal thiol reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ifi30 (IFI30 lysosomal thiol reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	IFI30 (IFI30 lysosomal thiol reductase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ifi30 (interferon gamma inducible protein 30)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ifi30 (IFI30 lysosomal thiol reductase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:dkey-197i20.6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C02D5.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG41378	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	GILT1	Alliance	DIOPT (Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	F37H8.5	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG9427	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	ZK669.2	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	ZK669.3	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	pqn-48	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ifi30	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	18,709,570 - 18,713,635 (+)	NCBI		GRCr8
mRatBN7.2	16	18,675,590 - 18,679,655 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	18,675,613 - 18,681,175 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	18,717,984 - 18,722,037 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	19,850,664 - 19,854,717 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	18,770,928 - 18,774,981 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	20,426,566 - 20,430,772 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	20,426,566 - 20,430,752 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	20,283,634 - 20,287,840 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	19,181,236 - 19,185,438 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	19,181,233 - 19,185,350 (+)	NCBI
Celera	16	18,867,868 - 18,872,074 (+)	NCBI		Celera
Cytogenetic Map	16	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute myeloid leukemia (ISO)

allergic contact dermatitis (ISO)

Megalencephaly-Polymicrogyria-Polydactyly-Hydrocephalus Syndrome 1 (ISO)

metabolic dysfunction-associated steatotic liver disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrobenzenesulfonic acid (EXP)

2,4-diaminotoluene (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,6-dinitrotoluene (EXP)

2-butoxyethanol (ISO)

2-hydroxypropanoic acid (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acetylsalicylic acid (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

amphetamine (EXP)

antirheumatic drug (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP)

carbon nanotube (ISO)

chlorophyllin (ISO)

choline (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dorsomorphin (ISO)

entinostat (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fenamidone (ISO)

fluoranthene (ISO)

folic acid (ISO)

fulvestrant (ISO)

gentamycin (EXP)

indometacin (ISO)

L-methionine (ISO)

Licochalcone B (ISO)

lidocaine (EXP)

lucanthone (ISO)

menadione (ISO)

methapyrilene (ISO)

methimazole (EXP)

nickel atom (ISO)

nickel sulfate (ISO)

nitrates (ISO)

okadaic acid (ISO)

paclitaxel (ISO)

panobinostat (ISO)

pemetrexed (ISO)

pentanal (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

propanal (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

SB 431542 (ISO)

silicon dioxide (EXP)

sodium arsenite (ISO)

sodium dichromate (ISO)

sulfadimethoxine (EXP)

sulforaphane (ISO)

sunitinib (ISO)

tamoxifen (ISO)

testosterone undecanoate (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

topiramate (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antigen processing and presentation of exogenous peptide antigen via MHC class I (IEA,ISO,ISS)

antigen processing and presentation of exogenous peptide antigen via MHC class II (IEA,ISO)

immune system process (IEA)

negative regulation of fibroblast proliferation (IEA,ISO)

protein stabilization (IEA,ISO)

Cellular Component

cell junction (IEA,ISO)

cytosol (IEA,ISO)

extracellular region (IEA)

lysosome (IBA,IEA,ISO,ISS)

Molecular Function

oxidoreductase activity (IEA)

oxidoreductase activity, acting on a sulfur group of donors (IBA,IEA,ISO,ISS)

oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

antigen processing and presentation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10639150	PMID:11701933	PMID:12477932	PMID:17142755	PMID:18218638	PMID:20538950

Genomics

Comparative Map Data

Ifi30
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	18,709,570 - 18,713,635 (+)	NCBI		GRCr8
mRatBN7.2	16	18,675,590 - 18,679,655 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	18,675,613 - 18,681,175 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	18,717,984 - 18,722,037 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	19,850,664 - 19,854,717 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	18,770,928 - 18,774,981 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	20,426,566 - 20,430,772 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	20,426,566 - 20,430,752 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	20,283,634 - 20,287,840 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	19,181,236 - 19,185,438 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	19,181,233 - 19,185,350 (+)	NCBI
Celera	16	18,867,868 - 18,872,074 (+)	NCBI		Celera
Cytogenetic Map	16	p14	NCBI

IFI30
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	18,173,813 - 18,178,117 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	18,173,162 - 18,178,117 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	18,284,623 - 18,288,927 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	18,145,579 - 18,149,927 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	18,145,578 - 18,149,927	NCBI
Celera	19	18,186,321 - 18,190,669 (+)	NCBI		Celera
Cytogenetic Map	19	p13.11	NCBI
HuRef	19	17,848,103 - 17,852,447 (+)	NCBI		HuRef
CHM1_1	19	18,284,148 - 18,288,492 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	18,307,946 - 18,312,247 (+)	NCBI		T2T-CHM13v2.0

Ifi30
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	71,215,418 - 71,219,307 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	71,215,419 - 71,219,307 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	70,762,773 - 70,766,663 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	70,762,774 - 70,766,663 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	73,286,672 - 73,290,562 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	73,691,762 - 73,695,638 (-)	NCBI		MGSCv36	mm8
Celera	8	73,324,071 - 73,327,964 (-)	NCBI		Celera
Cytogenetic Map	8	B3.3	NCBI
cM Map	8	34.15	NCBI

Ifi30
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955524	3,229,257 - 3,231,825 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955524	3,229,024 - 3,230,955 (-)	NCBI	ChiLan1.0	ChiLan1.0

IFI30
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	23,033,781 - 23,038,762 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	22,042,802 - 22,047,108 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	17,652,935 - 17,657,239 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	18,629,663 - 18,634,374 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	18,629,663 - 18,635,046 (+)	Ensembl	panpan1.1		panPan2

IFI30
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	44,819,862 - 44,823,261 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	44,819,893 - 44,823,342 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	44,733,377 - 44,736,798 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	45,305,204 - 45,308,613 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	45,305,216 - 45,308,597 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	44,542,363 - 44,545,785 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	44,952,851 - 44,956,279 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	45,228,348 - 45,231,774 (-)	NCBI		UU_Cfam_GSD_1.0

Ifi30
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	203,454,223 - 203,458,200 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936596	3,002,809 - 3,007,383 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936596	3,003,366 - 3,007,003 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IFI30
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	59,629,767 - 59,633,733 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	59,629,762 - 59,633,714 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	59,214,057 - 59,218,009 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

IFI30
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	16,644,361 - 16,649,599 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	16,644,392 - 16,649,751 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666074	2,730,359 - 2,735,694 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ifi30
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624908	1,525,185 - 1,527,978 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624908	1,525,290 - 1,528,202 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ifi30
8 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	51
Count of miRNA genes:	45
Interacting mature miRNAs:	48
Transcripts:	ENSRNOT00000026225
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631561	Hcuc2	Hepatic copper content QTL 2	2.8		liver copper amount (VT:0003065)	liver total copper weight (CMO:0001507)	16	1	39533949	Rat
1582235	Insul8	Insulin level QTL 8	3.3	0.0063	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	16	1	26727669	Rat
2307172	Activ4	Activity QTL 4	3.71	0.00023	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	1	33418960	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39533930	Rat
2302380	Slep6	Serum leptin concentration QTL 6	3.36		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	1	32139025	Rat
737819	Hcas4	Hepatocarcinoma susceptibility QTL 4	4.43		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	16	4227609	46975965	Rat
631517	Scl9	Serum cholesterol level QTL 9	3.3		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	16	15726433	21034895	Rat
9590151	Scort8	Serum corticosterone level QTL 8	8.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	16	1	30836262	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	44977551	Rat
61338	Bp23	Blood pressure QTL 23	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4227609	49227609	Rat
61405	Niddm6	Non-insulin dependent diabetes mellitus QTL 6	3.66	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	16	4227609	48972724	Rat
631830	Alc7	Alcohol consumption QTL 7	2.9		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	1	26727669	Rat
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	1	44588133	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	4227609	43025077	Rat
1600369	Hcas8	Hepatocarcinoma susceptibility QTL 8			liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	16	1	22477621	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4227609	60252231	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39533930	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	832236	59492508	Rat
2306902	Bp339	Blood pressure QTL 339		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	3380150	43025077	Rat
1300133	Rf24	Renal function QTL 24	3.64		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	16	3380150	21361552	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	832236	59492508	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	832236	59492508	Rat
634355	Rends4	Renal damage susceptibility QTL 4		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	16	1	26727669	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	832236	46053497	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	1	43534949	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	832236	59492508	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001030026	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC088256	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC099774	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225096	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229307	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230297	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232607	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233058	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233063	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233214	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234315	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026225 ⟹ ENSRNOP00000026225

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	18,675,631 - 18,679,866 (+)	Ensembl
Rnor_6.0 Ensembl	16	20,426,566 - 20,430,752 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097172 ⟹ ENSRNOP00000076870

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	18,675,613 - 18,681,175 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108678 ⟹ ENSRNOP00000078857

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	18,675,613 - 18,680,135 (+)	Ensembl

RefSeq Acc Id:

NM_001030026 ⟹ NP_001025197

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,709,570 - 18,713,635 (+)	NCBI
mRatBN7.2	16	18,675,590 - 18,679,655 (+)	NCBI
Rnor_6.0	16	20,426,566 - 20,430,772 (+)	NCBI
Rnor_5.0	16	20,283,634 - 20,287,840 (+)	NCBI
RGSC_v3.4	16	19,181,236 - 19,185,438 (+)	RGD
Celera	16	18,867,868 - 18,872,074 (+)	RGD

Sequence:

show sequence

CTGGAGCGGAGCCTTGAGGAAAGGGGGCCCAGAGTTAGGAGGAACCTGTGTGGGCGTGGTCTCA
GTGGGTGGAGCATCCACTTGCTTAAAGTCTCCCGCCTCCCCGGCCTGGCCAAGCTTTTTTCTCC
TCAGCCATGTCCTGTTCTCCGCTCGTACCATTCTTGTCCCTTTTGCTTCTGCTGTTCCTACCCG
AGGTTCCCAGAGCAGCCACTGCGTCCCTGCCGCAAGGATCCTCCGAGGGCGCAGCCACCTGCAA
GGCCCACGACCTGTGCCTCTTCGGGCCACGCCGGTTGCTCTCTGCACCACCTGTCAATGTCAGC
CTCTATTATGAGTCCCTGTGTGGAGCTTGTCGCTACTTCCTCGTCCGAAATTTGTTCCCAACCT
GGCTGATGGTTATGGAAATCATGAACATCACTCTGGTGCCCTACGGGAACGCACAGGAGAGAAA
TGTCAGCGGTACATGGGAGTTCACGTGCCAGCACGGGGAGCTGGAGTGTAAACTGAACAAGGTG
GAGGCCTGTCTGCTGGACAAGCTGGAAAAGGAGGCGGCATTCCTAACCATCGTCTGTATGGAGG
AGATGGAGGACATGGAGAAGAAACTGGGCCCGTGCCTGCAGCTGTATGTTCCAGAGGTGTCACC
AGAAAGCATCATGGAGTGTGCCACCGGAAAACGAGGCACAGAGCTGATGCATGAGAACGCCCAG
CTCACAGATGCCCTACAGCCACCCCATGAGTATGTGCCCTGGGTCCTGGTCAACGAGAAACCGT
TGACGGACCCCAGCCAGCTCCTGAGCTCCGTTTGTGAGCTGTACCAGGGGACAGAGAAGCCAGA
CATCTGCTCCTCCATGGCTGATGCCCCCAGGGAGGTCTGCTATAAGTGAAGGTCATTGTCCCAA
GAAAAACTACTCAGCTTGAAGTGGAGGAGTCTGCAAGAGCTGCTGACCAGCCATGGAGTCCTGC
ACGTGTCCCACAAAACCCAGATGCAAAACTCGGAGTCAAGAATCTTGCCTTATTTTCAAATGGT
GCTAAATTCAAATCCACACAATACATCATCCACATTGCTGTGATTCCCTTTTCCTGAGGTTGGA
GTTTGTGTTTTTATCTTTAATGTGGAGCTGTAACTCAGGGTTTTGCTCATGCTCAGCACACAAT
GCCCCACACCCTGGAGTTCAAGCCTCATCAGAAAAGCCAAAAGGTGGGGTTGGGGATTTAGCTC
AGTGGTAGAGCCCTGGTGTAAGGCCCTGGGTTCAGTCCCCAGCTCCGAAAAAAAGAAAAAAAAA
AAAGCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001025197	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88256	(Get FASTA)	NCBI Sequence Viewer
	AAH99774	(Get FASTA)	NCBI Sequence Viewer
	EDL90735	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026225
	ENSRNOP00000026225.4
GenBank Protein	Q499T2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001025197 ⟸ NM_001030026
- Peptide Label:	precursor
- UniProtKB:	Q5I0J7 (UniProtKB/Swiss-Prot), Q499T2 (UniProtKB/Swiss-Prot), A0A8I5Y6G3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSCSPLVPFLSLLLLLFLPEVPRAATASLPQGSSEGAATCKAHDLCLFGPRRLLSAPPVNVSLY YESLCGACRYFLVRNLFPTWLMVMEIMNITLVPYGNAQERNVSGTWEFTCQHGELECKLNKVEA CLLDKLEKEAAFLTIVCMEEMEDMEKKLGPCLQLYVPEVSPESIMECATGKRGTELMHENAQLT DALQPPHEYVPWVLVNEKPLTDPSQLLSSVCELYQGTEKPDICSSMADAPREVCYK hide sequence

Ensembl Acc Id:

ENSRNOP00000026225 ⟸ ENSRNOT00000026225

Ensembl Acc Id:

ENSRNOP00000076870 ⟸ ENSRNOT00000097172

Ensembl Acc Id:

ENSRNOP00000078857 ⟸ ENSRNOT00000108678

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q499T2-F1-model_v2	AlphaFold	Q499T2	1-248	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700017

Promoter ID:

EPDNEW_R10539

Type:

single initiation site

Name:

Ifi30_1

Description:

IFI30, lysosomal thiol reductase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	20,426,680 - 20,426,740	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310758	AgrOrtholog
BioCyc Gene	G2FUF-11807	BioCyc
Ensembl Genes	ENSRNOG00000019387	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000026225	ENTREZGENE
	ENSRNOT00000026225.8	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7375607	IMAGE-MGC_LOAD
	IMAGE:7932222	IMAGE-MGC_LOAD
InterPro	Interferon-induced_GILT	UniProtKB/Swiss-Prot
KEGG Report	rno:290644	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109077	IMAGE-MGC_LOAD
	MGC:124690	IMAGE-MGC_LOAD
NCBI Gene	290644	ENTREZGENE
PANTHER	GAMMA-INTERFERON-INDUCIBLE LYSOSOMAL THIOL REDUCTASE	UniProtKB/Swiss-Prot
	PTHR13234	UniProtKB/Swiss-Prot
Pfam	GILT	UniProtKB/Swiss-Prot
PhenoGen	Ifi30	PhenoGen
RatGTEx	ENSRNOG00000019387	RatGTEx
UniProt	A0A8I5Y6G3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZLL2_RAT	UniProtKB/TrEMBL
	GILT_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q5I0J7	ENTREZGENE
UniProt Secondary	Q5I0J7	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-05-04	Ifi30	IFI30, lysosomal thiol reductase	Ifi30	interferon gamma inducible protein 30	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Ifi30	interferon gamma inducible protein 30	Ifi30_predicted	interferon gamma inducible protein 30 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Ifi30_predicted	interferon gamma inducible protein 30 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)