Ndufb3 (NADH:ubiquinone oxidoreductase subunit B3)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ndufb3 (NADH:ubiquinone oxidoreductase subunit B3) Rattus norvegicus

Analyze

Symbol:

Ndufb3

Name:

NADH:ubiquinone oxidoreductase subunit B3

RGD ID:

1310737

Description:

Predicted to be involved in mitochondrial respiratory chain complex I assembly. Predicted to be located in mitochondrial inner membrane. Predicted to be part of mitochondrial respiratory chain complex I. Human ortholog(s) of this gene implicated in nuclear type mitochondrial complex I deficiency 25. Orthologous to human NDUFB3 (NADH:ubiquinone oxidoreductase subunit B3); PARTICIPATES IN Alzheimer's disease pathway; Huntington's disease pathway; oxidative phosphorylation pathway; INTERACTS WITH 2,3',4,4',5-Pentachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC301427; NADH dehydrogenase (ubiquinone) 1 beta subcomplex 3; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	9	60,129,240 - 60,139,452 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	60,129,154 - 60,139,446 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	68,623,673 - 68,634,023 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	9	73,739,618 - 73,749,968 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	9	72,057,879 - 72,068,231 (+)	NCBI	Rnor_WKY
Rnor_6.0	9	65,478,496 - 65,488,708 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	65,478,496 - 65,488,702 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	65,285,887 - 65,296,099 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	57,252,769 - 57,262,981 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	57,399,754 - 57,409,928 (+)	NCBI
Celera	9	57,570,576 - 57,580,788 (+)	NCBI		Celera
Cytogenetic Map	9	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Alzheimer's disease (ISO)

autoimmune lymphoproliferative syndrome type 2B (ISO)

Autoimmune Lymphoproliferative Syndrome, Type V (ISO)

cataract (ISO)

common variable immunodeficiency 1 (ISO)

epilepsy (ISO)

genetic disease (ISO)

mitochondrial complex I deficiency (ISO)

Neurodevelopmental Disorders (ISO)

nuclear type mitochondrial complex I deficiency 25 (ISO)

Pulmonary Arterial Hypertension (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3',4,4',5-Pentachlorobiphenyl (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

4,4'-diaminodiphenylmethane (ISO)

4-hydroxyphenyl retinamide (ISO)

arsenite(3-) (ISO)

azoxystrobin (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

chlorpyrifos (EXP)

clobetasol (ISO)

clofibrate (ISO)

clofibric acid (EXP)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dicrotophos (ISO)

doxorubicin (ISO)

folic acid (ISO)

genistein (ISO)

isobutanol (ISO)

isoniazide (ISO)

isotretinoin (ISO)

ivermectin (ISO)

lamivudine (ISO)

lead(0) (ISO)

lead(2+) (ISO)

lipopolysaccharide (ISO)

N,N-diethyl-m-toluamide (EXP)

paracetamol (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

permethrin (EXP)

phenobarbital (ISO)

picoxystrobin (ISO)

pirinixic acid (ISO)

Pyridostigmine bromide (EXP)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (ISO)

sevoflurane (ISO)

sodium arsenite (ISO)

Soman (EXP)

thapsigargin (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

toluene (EXP)

trichloroethene (EXP)

tungsten (ISO)

tunicamycin (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

zidovudine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

electron transport chain (IEA)

mitochondrial respiratory chain complex I assembly (IBA,ISO)

Cellular Component

mitochondrial respiratory chain complex I (IBA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Alzheimer's disease pathway (IEA)

Huntington's disease pathway (IEA)

oxidative phosphorylation pathway (IEA)

Parkinson's disease pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Reduced Mitochondrial Activity is Early and Steady in the Entorhinal Cortex but it is Mainly Unmodified in the Frontal Cortex in Alzheimer's Disease.	Armand-Ugon M, etal., Curr Alzheimer Res. 2017;14(12):1327-1334. doi: 10.2174/1567205014666170505095921.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:12611891	PMID:12865426	PMID:14651853	PMID:18614015	PMID:23376485	PMID:27626371	PMID:28844695

Genomics

Comparative Map Data

Ndufb3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	9	60,129,240 - 60,139,452 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	60,129,154 - 60,139,446 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	68,623,673 - 68,634,023 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	9	73,739,618 - 73,749,968 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	9	72,057,879 - 72,068,231 (+)	NCBI	Rnor_WKY
Rnor_6.0	9	65,478,496 - 65,488,708 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	65,478,496 - 65,488,702 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	65,285,887 - 65,296,099 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	57,252,769 - 57,262,981 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	57,399,754 - 57,409,928 (+)	NCBI
Celera	9	57,570,576 - 57,580,788 (+)	NCBI		Celera
Cytogenetic Map	9	q31	NCBI

NDUFB3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	201,072,001 - 201,085,750 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	2	201,071,433 - 201,085,750 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	201,936,724 - 201,950,473 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	201,644,779 - 201,658,710 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	201,762,039 - 201,775,970	NCBI
Celera	2	195,691,087 - 195,705,098 (+)	NCBI		Celera
Cytogenetic Map	2	q33.1	NCBI
HuRef	2	193,787,966 - 193,801,894 (+)	NCBI		HuRef
CHM1_1	2	201,942,480 - 201,956,491 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	201,555,443 - 201,569,193 (+)	NCBI		T2T-CHM13v2.0

Ndufb3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	58,625,556 - 58,635,123 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	58,625,543 - 58,635,123 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	58,586,397 - 58,595,964 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	58,586,384 - 58,595,964 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	58,643,443 - 58,652,792 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	58,531,145 - 58,540,494 (+)	NCBI		MGSCv36	mm8
Celera	1	59,106,184 - 59,115,486 (+)	NCBI		Celera
Cytogenetic Map	1	C1.3	NCBI

Ndufb3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	477,144 - 483,122 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955403	477,138 - 483,122 (-)	NCBI	ChiLan1.0	ChiLan1.0

NDUFB3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	2B	103,713,797 - 103,727,575 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	88,329,424 - 88,343,180 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	206,487,855 - 206,501,709 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	206,487,905 - 206,501,709 (+)	Ensembl	panpan1.1		panPan2

NDUFB3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	37	10,240,109 - 10,247,487 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	37	10,240,213 - 10,247,486 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	37	11,124,653 - 11,132,816 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	37	10,144,770 - 10,152,924 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	37	10,145,621 - 10,157,006 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	37	10,126,399 - 10,134,586 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	37	10,104,329 - 10,112,494 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	37	10,098,151 - 10,106,332 (+)	NCBI		UU_Cfam_GSD_1.0

Ndufb3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	158,368,034 - 158,379,651 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936726	338,423 - 349,943 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936726	338,384 - 349,943 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NDUFB3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	104,747,678 - 104,759,139 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	104,747,835 - 104,759,137 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	116,072,351 - 116,083,636 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NDUFB3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	86,723,212 - 86,735,837 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	86,723,253 - 86,735,980 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	112,683,374 - 112,696,127 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ndufb3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624889	131,732 - 141,915 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624889	126,294 - 141,572 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ndufb3
20 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	181
Count of miRNA genes:	147
Interacting mature miRNAs:	161
Transcripts:	ENSRNOT00000016060
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10054125	Srcrt7	Stress Responsive Cort QTL 7	3.33	0.0011	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	9	1	87073594	Rat
1331757	Cdexp1	CD45RC expression in CD8 T cells QTL 1	4.3		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	9	1024537	67509080	Rat
631680	Cm11	Cardiac mass QTL 11	3.1	0.00089	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	9	20430519	65430519	Rat
70186	Niddm26	Non-insulin dependent diabetes mellitus QTL 26	3.87		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	9	22071169	86369743	Rat
631643	Bp120	Blood pressure QTL 120	3	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	22071200	67071200	Rat
1300180	Bw14	Body weight QTL 14	3.776		body mass (VT:0001259)	body weight (CMO:0000012)	9	23754024	61381613	Rat
7207814	Bmd91	Bone mineral density QTL 91	3.5		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	9	23754144	83851531	Rat
70218	Cm28	Cardiac mass QTL 28	8.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	25268044	79271759	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	25268044	114175309	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	25661188	100929786	Rat
1641894	Alcrsp12	Alcohol response QTL 12			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	27468639	72468639	Rat
7411656	Foco26	Food consumption QTL 26	9.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	32535505	77535505	Rat
7411571	Bw138	Body weight QTL 138	14.3	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	9	32535505	77535505	Rat
1598834	Memor11	Memory QTL 11	2.5		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	9	36962359	77814038	Rat
8662828	Vetf6	Vascular elastic tissue fragility QTL 6	3.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	9	36962359	92058970	Rat
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	36962359	95410867	Rat
6903941	Pur31	Proteinuria QTL 31		0.036	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	9	40194188	85194188	Rat
11353949	Bp393	Blood pressure QTL 393			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	40194188	85194188	Rat
61352	Bp34	Blood pressure QTL 34	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	42495343	79271511	Rat
10058949	Gmadr5	Adrenal mass QTL 5	2	0.014	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	9	42791513	87976209	Rat
11353951	Bp394	Blood pressure QTL 394			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	44649921	89649921	Rat
12879506	Pur33	Proteinuria QTL 33			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	44649921	89649921	Rat
11353957	Bmd92	Bone mineral density QTL 92		0.01	tibia mineral mass (VT:1000283)	volumetric bone mineral density (CMO:0001553)	9	46114199	91114199	Rat
631656	Bp108	Blood pressure QTL 108	5.97	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	48598251	93598251	Rat
1598849	Memor17	Memory QTL 17	2.2		exploratory behavior trait (VT:0010471)	difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678)	9	49968546	71098346	Rat
2303170	Bp332	Blood pressure QTL 332	3.73	0.027	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	55847841	77026453	Rat
2303180	Bp333	Blood pressure QTL 333		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	56627713	78595166	Rat
2303180	Bp333	Blood pressure QTL 333		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	9	56627713	78595166	Rat
2303180	Bp333	Blood pressure QTL 333		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	56627713	78595166	Rat
1578760	Cm53	Cardiac mass QTL 53	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	56771635	101771635	Rat
724515	Uae16	Urinary albumin excretion QTL 16	8		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	58163035	100929646	Rat

Markers in Region

RH138670

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	83,113,432 - 83,113,679 (+)	MAPPER	mRatBN7.2
mRatBN7.2	2	216,164,169 - 216,164,413 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	232,033,215 - 232,033,458	NCBI	Rnor6.0
Rnor_6.0	17	87,490,477 - 87,490,723	NCBI	Rnor6.0
Rnor_5.0	17	89,181,425 - 89,181,671	UniSTS	Rnor5.0
Rnor_5.0	2	251,378,703 - 251,378,946	UniSTS	Rnor5.0
RGSC_v3.4	2	224,967,472 - 224,967,715	UniSTS	RGSC3.4
RGSC_v3.4	17	94,592,933 - 94,593,179	UniSTS	RGSC3.4
Celera	17	82,379,911 - 82,380,157	UniSTS
Celera	2	208,479,226 - 208,479,469	UniSTS
Cytogenetic Map	2	q42	UniSTS
Cytogenetic Map	17	q12.3	UniSTS
Cytogenetic Map	9	q31	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106912	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039083300	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039083301	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC123462	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473965	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000214	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000016060 ⟹ ENSRNOP00000016060

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	60,129,240 - 60,139,446 (+)	Ensembl
Rnor_6.0 Ensembl	9	65,478,496 - 65,488,702 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000110546 ⟹ ENSRNOP00000077048

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	60,129,154 - 60,139,446 (+)	Ensembl

RefSeq Acc Id:

NM_001106912 ⟹ NP_001100382

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	9	60,129,240 - 60,139,452 (+)	NCBI
Rnor_6.0	9	65,478,496 - 65,488,708 (+)	NCBI
Rnor_5.0	9	65,285,887 - 65,296,099 (+)	NCBI
RGSC_v3.4	9	57,252,769 - 57,262,981 (+)	RGD
Celera	9	57,570,576 - 57,580,788 (+)	RGD

Sequence:

show sequence

GCAAGGAGAACAAGGCTTCATCGTCCTCCTCCTCCGTGTCTCCTACCGCAGTCAAACTCCAGCT
GCAAAGAGTAGAAAACAATATCGACTTCCAGGCTTTTTCATGTCATCTCTGTCTTGTCTGGGAG
CCTTGCGCTAGTCCCGGAACGTTTACTATCTCCTCCACTTTCCTGTCGTAAGAAACTAGAGGAA
ACAACGTCCGTTTCCGGTTGGCTCCAGCTGGAAGGTTGAATATTGAGTGTCCTGGGAGGTCACA
TTGCTGTCAGACATGGCTGCTGGACATGGTCACGAACACGGACATGGTCATGGTAAAATGGAAC
TTCCAGATTACAGACAGTGGAAAATTGAAGGGACGCCATTAGAAGCAATGCAGAAGAAGCTTGC
TGCACGAGGGCTGAGGGATCCATGGGCTCGCAATGAGGCTTGGAGATACATGGGCGGCTTTGCA
GACAATATCACCTTCACGAGCGTAATGTTAAAAGGATTCAAATGGGGGTTTGCTGCGTTTGTGG
TAGCTTTAGGGGCCGAGTATTTCCTGACTTCCCATGAGGATAAGAAGCATCACTGAAGAGAGCA
CCTGTGACGTCTTCCATGAAAATAAGATTTCTCTCACCATAGCATCCTTGGCTGTGTGTCTGTC
CTTGAAAGAATATTGTATGGTTTAATAAAGCAAGAAAAACTGTGGGTTTTTTGTAACTATTAAA
TAAAATTAAAAAG

hide sequence

RefSeq Acc Id:

XM_039083300 ⟹ XP_038939228

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	9	60,133,360 - 60,139,451 (+)	NCBI

RefSeq Acc Id:

XM_039083301 ⟹ XP_038939229

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	9	60,129,328 - 60,139,419 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001100382	(Get FASTA)	NCBI Sequence Viewer
	XP_038939228	(Get FASTA)	NCBI Sequence Viewer
	XP_038939229	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL98984	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001100382 ⟸ NM_001106912
- UniProtKB:	D4A4P3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAAGHGHEHGHGHGKMELPDYRQWKIEGTPLEAMQKKLAARGLRDPWARNEAWRYMGGFADNIT FTSVMLKGFKWGFAAFVVALGAEYFLTSHEDKKHH hide sequence

RefSeq Acc Id:

ENSRNOP00000016060 ⟸ ENSRNOT00000016060

RefSeq Acc Id:	XP_038939229 ⟸ XM_039083301
- Peptide Label:	isoform X2
- UniProtKB:	D4A4P3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038939228 ⟸ XM_039083300
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5Y9A4 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000077048 ⟸ ENSRNOT00000110546

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A4P3-F1-model_v2	AlphaFold	D4A4P3	1-99	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696690

Promoter ID:

EPDNEW_R7215

Type:

initiation region

Name:

Ndufb3_2

Description:

NADH:ubiquinone oxidoreductase subunit B3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R7216

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	65,478,481 - 65,478,541	EPDNEW

RGD ID:

13696691

Promoter ID:

EPDNEW_R7216

Type:

multiple initiation site

Name:

Ndufb3_1

Description:

NADH:ubiquinone oxidoreductase subunit B3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R7215

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	65,478,693 - 65,478,753	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310737	AgrOrtholog
BioCyc Gene	G2FUF-27443	BioCyc
BioCyc Pathway	PWY-3781 [aerobic respiration I (cytochrome c)]	BioCyc
Ensembl Genes	ENSRNOG00000011825	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000016060	ENTREZGENE
	ENSRNOP00000016060.5	UniProtKB/TrEMBL
	ENSRNOP00000077048	ENTREZGENE
	ENSRNOP00000077048.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000016060	ENTREZGENE
	ENSRNOT00000016060.6	UniProtKB/TrEMBL
	ENSRNOT00000110546	ENTREZGENE
	ENSRNOT00000110546.1	UniProtKB/TrEMBL
InterPro	NDUFB3	UniProtKB/TrEMBL
KEGG Report	rno:301427	UniProtKB/TrEMBL
NCBI Gene	301427	ENTREZGENE
PANTHER	NADH DEHYDROGENASE [UBIQUINONE] 1 BETA SUBCOMPLEX SUBUNIT 3	UniProtKB/TrEMBL
	PTHR15082	UniProtKB/TrEMBL
Pfam	NDUF_B12	UniProtKB/TrEMBL
PhenoGen	Ndufb3	PhenoGen
UniProt	A0A8I5Y9A4	ENTREZGENE, UniProtKB/TrEMBL
	D4A4P3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-01	Ndufb3	NADH:ubiquinone oxidoreductase subunit B3	Ndufb3	NADH dehydrogenase (ubiquinone) 1 beta subcomplex 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Ndufb3	NADH dehydrogenase (ubiquinone) 1 beta subcomplex 3	Ndufb3_predicted	NADH dehydrogenase (ubiquinone) 1 beta subcomplex 3 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Ndufb3_predicted	NADH dehydrogenase (ubiquinone) 1 beta subcomplex 3 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)