Slc25a2 (solute carrier family 25 member 2)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Slc25a2 (solute carrier family 25 member 2) Rattus norvegicus

Analyze

Symbol:

Slc25a2

Name:

solute carrier family 25 member 2

RGD ID:

1310667

Description:

Predicted to enable L-arginine transmembrane transporter activity; L-lysine transmembrane transporter activity; and L-ornithine transmembrane transporter activity. Predicted to be involved in L-alpha-amino acid transmembrane transport and ornithine metabolic process. Predicted to be located in membrane. Predicted to be active in mitochondrion. Orthologous to human SLC25A2 (solute carrier family 25 member 2); PARTICIPATES IN 2-aminoadipic 2-oxoadipic aciduria pathway; glutaric aciduria type I pathway; hyperlysinemia pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; copper atom.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC291640; mitochondrial ornithine transporter 2; solute carrier family 25 (mitochondrial carrier, ornithine transporter) member 2

RGD Orthologs

Human

Mouse

Bonobo

Dog

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	18	29,452,943 - 29,457,906 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	29,453,582 - 29,460,383 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	29,557,293 - 29,560,674 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	18	30,319,302 - 30,322,683 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	18	29,654,627 - 29,658,008 (-)	NCBI	Rnor_WKY
Rnor_6.0	18	30,774,205 - 30,775,401 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	30,774,205 - 30,775,401 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	30,470,432 - 30,471,628 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	30,536,488 - 30,537,684 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	30,563,379 - 30,564,385 (-)	NCBI
Celera	18	29,102,009 - 29,103,205 (-)	NCBI		Celera
Cytogenetic Map	18	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal dominant intellectual developmental disorder 31 (ISO)

familial adenomatous polyposis 1 (ISO)

genetic disease (ISO)

Hereditary Neoplastic Syndromes (ISO)

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

copper atom (EXP)

copper(0) (EXP)

ethanol (ISO)

furan (EXP)

gentamycin (EXP)

hydroquinone O-beta-D-glucopyranoside (ISO)

kojic acid (ISO)

lamivudine (ISO)

levonorgestrel (ISO)

paracetamol (EXP,ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

testosterone undecanoate (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

vinclozolin (EXP)

zidovudine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

L-arginine transmembrane transport (ISO)

L-lysine transmembrane transport (ISO)

L-ornithine transmembrane transport (ISO)

mitochondrial L-ornithine transmembrane transport (IBA,ISO)

ornithine metabolic process (ISO)

Cellular Component

membrane (IEA)

mitochondrion (IBA,ISO)

Molecular Function

L-arginine transmembrane transporter activity (ISO)

L-lysine transmembrane transporter activity (ISO)

L-ornithine transmembrane transporter activity (IBA,ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

2-aminoadipic 2-oxoadipic aciduria pathway (ISO)

glutaric aciduria type I pathway (ISO)

hyperlysinemia pathway (ISO)

lysine degradation pathway (ISO)

saccharopinuria pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:12807890	PMID:12948741	PMID:18614015

Genomics

Comparative Map Data

Slc25a2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	18	29,452,943 - 29,457,906 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	29,453,582 - 29,460,383 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	29,557,293 - 29,560,674 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	18	30,319,302 - 30,322,683 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	18	29,654,627 - 29,658,008 (-)	NCBI	Rnor_WKY
Rnor_6.0	18	30,774,205 - 30,775,401 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	30,774,205 - 30,775,401 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	30,470,432 - 30,471,628 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	30,536,488 - 30,537,684 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	30,563,379 - 30,564,385 (-)	NCBI
Celera	18	29,102,009 - 29,103,205 (-)	NCBI		Celera
Cytogenetic Map	18	p11	NCBI

SLC25A2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	141,302,635 - 141,304,049 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	5	141,302,635 - 141,304,049 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	140,682,202 - 140,683,616 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	140,662,380 - 140,663,796 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	140,662,379 - 140,663,616	NCBI
Celera	5	136,759,021 - 136,760,437 (-)	NCBI		Celera
Cytogenetic Map	5	q31.3	NCBI
HuRef	5	135,827,253 - 135,828,669 (-)	NCBI		HuRef
CHM1_1	5	140,115,401 - 140,116,817 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	141,827,934 - 141,829,348 (-)	NCBI		T2T-CHM13v2.0

Slc25a2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	37,770,431 - 37,771,776 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	37,770,431 - 37,771,776 (-)	Ensembl		GRCm39 Ensembl
GRCm38	18	37,637,378 - 37,638,723 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	37,637,378 - 37,638,723 (-)	Ensembl	GRCm38		mm10	GRCm38
GRCm38.p6 Ensembl	18	37,637,377 - 37,638,745 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	37,797,032 - 37,798,377 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	37,763,352 - 37,764,697 (-)	NCBI		MGSCv36	mm8
Celera	18	38,969,866 - 38,971,211 (-)	NCBI		Celera
Cytogenetic Map	18	B3	NCBI

SLC25A2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	5	134,691,724 - 134,695,284 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	136,664,485 - 136,666,344 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	142,778,348 - 142,779,770 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

SLC25A2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	36,286,080 - 36,287,619 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	36,286,584 - 36,287,489 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	33,337,980 - 33,339,519 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	36,740,699 - 36,742,238 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	36,741,203 - 36,742,108 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	33,814,742 - 33,816,281 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	34,625,750 - 34,627,289 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	35,433,398 - 35,434,937 (-)	NCBI		UU_Cfam_GSD_1.0

SLC25A2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	142,944,078 - 142,944,980 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	142,943,565 - 142,947,313 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	149,142,741 - 149,144,549 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SLC25A2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	43,922,525 - 43,924,166 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	43,922,816 - 43,923,721 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	33,930,087 - 33,931,925 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slc25a2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624774	541,115 - 542,020 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624774	540,820 - 542,200 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Slc25a2
13 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	127
Count of miRNA genes:	97
Interacting mature miRNAs:	111
Transcripts:	ENSRNOT00000027128
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312598	Bp340	Blood pressure QTL 340		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	1	30558703	Rat
2300180	Bmd67	Bone mineral density QTL 67	4.8	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	18	1	34291613	Rat
2293661	Bss50	Bone structure and strength QTL 50	4.64	0.0003	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	18	1	34291613	Rat
61388	Bp2	Blood pressure QTL 2	3.23		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	1	35374722	Rat
9589153	Insul31	Insulin level QTL 31	7.15	0.05	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	18	1	42547119	Rat
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4207941	60377792	Rat
2312568	Glom21	Glomerulus QTL 21	2	0.005	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	5185858	40503530	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	11791518	63636873	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
61382	Bp46	Blood pressure QTL 46	18.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11941791	31393320	Rat
631264	Scl22	Serum cholesterol level QTL 22	6.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	18	11941791	31393320	Rat
1331766	Bp236	Blood pressure QTL 236	3.022		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	11944299	31359530	Rat
61375	Bp41	Blood pressure QTL 41	2.4		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	18	11944299	41122201	Rat
1331753	Bp231	Blood pressure QTL 231	3.643		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944299	52293055	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	11944299	59330563	Rat
6903359	Bp355	Blood pressure QTL 355	3.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944544	59796478	Rat
2313082	Bss85	Bone structure and strength QTL 85	0.8	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	18	14951337	59951337	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	18007599	63571040	Rat
1331735	Rf44	Renal function QTL 44	2.981		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	18	18234564	31359530	Rat
1331775	Bp235	Blood pressure QTL 235	3.201		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	18234564	31359530	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
1641923	Colcr8	Colorectal carcinoma resistance QTL 8	3.1	0.0014	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	22066242	52293055	Rat
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25570985	70570985	Rat
12904673	Cm127	Cardiac mass QTL 127		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	26548082	46969551	Rat
12904675	Am19	Aortic mass QTL 19		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	26548082	46969551	Rat
12904677	Kidm72	Kidney mass QTL 72		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	26548082	46969551	Rat
12904668	Bw188	Body weight QTL 188		0.03	body mass (VT:0001259)	body weight (CMO:0000012)	18	26548082	46969551	Rat
12904669	Cm125	Cardiac mass QTL 125		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	26548082	46969551	Rat
12904670	Cm126	Cardiac mass QTL 126		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	26548082	46969551	Rat
2301413	Bp318	Blood pressure QTL 318		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	26548082	46969551	Rat
2293704	Bss35	Bone structure and strength QTL 35	4.59	0.0002	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	18	28964853	73964853	Rat
2300157	Bmd66	Bone mineral density QTL 66	13.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
2300177	Bmd65	Bone mineral density QTL 65	19.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat

Markers in Region

UniSTS:487609

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	29,455,162 - 29,456,173 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	30,774,375 - 30,775,385	NCBI	Rnor6.0
Rnor_5.0	18	30,470,602 - 30,471,612	UniSTS	Rnor5.0
RGSC_v3.4	18	30,536,658 - 30,537,668	UniSTS	RGSC3.4
Celera	18	29,102,179 - 29,103,189	UniSTS
Cytogenetic Map	18	p11	UniSTS

UniSTS:547042

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	29,455,048 - 29,455,359 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	30,774,261 - 30,774,571	NCBI	Rnor6.0
Rnor_5.0	18	30,470,488 - 30,470,798	UniSTS	Rnor5.0
Celera	18	29,102,065 - 29,102,375	UniSTS
Cytogenetic Map	18	p11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			2		2					2	10	3
Low	3	43	55	41	17	41	8	11	74	33	31	8	8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106152	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096708	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473974	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000299	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000027128 ⟹ ENSRNOP00000027128

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	18	30,774,205 - 30,775,401 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000104173 ⟹ ENSRNOP00000083084

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	29,453,582 - 29,460,383 (-)	Ensembl

RefSeq Acc Id:

NM_001106152 ⟹ NP_001099622

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	18	29,454,993 - 29,456,189 (-)	NCBI
Rnor_6.0	18	30,774,205 - 30,775,401 (-)	NCBI
Rnor_5.0	18	30,470,432 - 30,471,628 (-)	NCBI
RGSC_v3.4	18	30,536,488 - 30,537,684 (-)	RGD
Celera	18	29,102,009 - 29,103,205 (-)	RGD

Sequence:

show sequence

ATGAAATCCACCCTGCCATCCAAGCCGCCATAGACCTCACTGCCGGCGCAGCAGGGGCCGCAGC
GTGTGTGCTGACCGGGCAGCCCTTCGACACCGTAAAAGTAAAGATGCAGACATTTCCCTACATG
TACAAAGGCCTCGCTGACTGTTTCCTAAAGACATACAACCAAGTGGGTGTCCACGGCCTTTACA
GGGGAACCAGTCCTGCACTGTTAGCCTATGTCGCCCAGGGCTCTGTCCTATTTTTGTGCTATGG
CTTTTGCCAACAGTTTGTCAGGAAAGTGGCAAGAGTGGAGCAGAGTGCAGAACTGAACGACTTT
GAGACTGCCACTGCTGGGTCACTGGCTTCTGCATTTGCTGCGCTGGTCCTCTGCCCCACTGAGC
TTGTGAAGTGTCGGCTGCAGACTATGCATGAAATGAGGGTGGCAGGGAAGACAAAACACAGCCA
CAACACAATTTGGTCTATGGTTAAGAGTATCTTCATGAAGGATGGTCCCTTAGGCTTCTATCGT
GGACTCTCAACCACTCTTGCTCAGGAAATACCTGGATACTTCTTCTACTTTGGGGGCTATGAAA
TCAGTCGATCATTTTTTGCGTCAGGGGGATCAAAGGATGAACTAGGTCCTGTCCCTTTGATGTT
AAGTGGAAGCTTTGCTGGGGTTTGTCTCTGGCTTATCATATTCCCAGTAGACTGCATTAAATCC
AGAATCCAGGTTCTTTCTATGTTTGGGAAGCCTGCAGGATTAATTAAAACCTTTATAAATGTTG
TGAGAAATGAAGGAATATTAGCCTTGTATTCTGGATTGAAAGCCACTCTGATTCGAGCCATCCC
TTCCAATGCTGCTCTATTTGTGGTTTATGAATACAGCAGAAAGATGATGATGAATGTGGTAGAA
GAATACTGAAGTGTCTTGATGAATCCTTGTCTGAGCACACCAATGTGAGGACCACAGCTCTACA
TGTCAAAGAGTTCAAGACCAACATGGAGTTATCTTTGACTGGGAATTTCGGGTTTGTCTTCCCT
TCCTCAGATCTCAAACCTTGTGGAGAGATCTTTATAGCATATGTTTTTTTTCTGCAGTCCTTCT
GAAATAGGAAAATCACTACTTTTGCTGATGGTGGGATCTACAGGGTGAACCCAAGACCCTATGT
ACTTAATTATCAGGGCTTCTTCATAAATCTATATATGCATCTTGA

hide sequence

RefSeq Acc Id:

XM_039096708 ⟹ XP_038952636

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	18	29,452,943 - 29,457,906 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001099622	(Get FASTA)	NCBI Sequence Viewer
	XP_038952636	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL76361	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_001099622 ⟸ NM_001106152

- UniProtKB:

D3ZMM0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MQTFPYMYKGLADCFLKTYNQVGVHGLYRGTSPALLAYVAQGSVLFLCYGFCQQFVRKVARVEQ
SAELNDFETATAGSLASAFAALVLCPTELVKCRLQTMHEMRVAGKTKHSHNTIWSMVKSIFMKD
GPLGFYRGLSTTLAQEIPGYFFYFGGYEISRSFFASGGSKDELGPVPLMLSGSFAGVCLWLIIF
PVDCIKSRIQVLSMFGKPAGLIKTFINVVRNEGILALYSGLKATLIRAIPSNAALFVVYEYSRK
MMMNVVEEY

hide sequence

RefSeq Acc Id:

ENSRNOP00000027128 ⟸ ENSRNOT00000027128

RefSeq Acc Id:	XP_038952636 ⟸ XM_039096708
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6G8E8 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000083084 ⟸ ENSRNOT00000104173

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZMM0-F1-model_v2	AlphaFold	D3ZMM0	1-265	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310667	AgrOrtholog
BioCyc Gene	G2FUF-7817	BioCyc
Ensembl Genes	ENSRNOG00000027359	Ensembl
	ENSRNOG00000068493	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000083084	ENTREZGENE
	ENSRNOP00000083084.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000104173	ENTREZGENE
	ENSRNOT00000104173.1	UniProtKB/TrEMBL
Gene3D-CATH	1.50.40.10	UniProtKB/TrEMBL
InterPro	Mitochondrial_sb/sol_carrier	UniProtKB/TrEMBL
	Mt_carrier_dom_sf	UniProtKB/TrEMBL
NCBI Gene	291640	ENTREZGENE
PANTHER	MITOCHONDRIAL BASIC AMINO ACIDS TRANSPORTER-RELATED	UniProtKB/TrEMBL
	MITOCHONDRIAL ORNITHINE TRANSPORTER 2	UniProtKB/TrEMBL
Pfam	Mito_carr	UniProtKB/TrEMBL
PhenoGen	Slc25a2	PhenoGen
PROSITE	SOLCAR	UniProtKB/TrEMBL
Superfamily-SCOP	SSF103506	UniProtKB/TrEMBL
UniProt	A0A8I6G8E8	ENTREZGENE, UniProtKB/TrEMBL
	D3ZMM0	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-09	Slc25a2	solute carrier family 25 member 2	Slc25a2	solute carrier family 25 (mitochondrial carrier, ornithine transporter) member 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Slc25a2	solute carrier family 25 (mitochondrial carrier, ornithine transporter) member 2	Slc25a2_predicted	solute carrier family 25 (mitochondrial carrier, ornithine transporter) member 2 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Slc25a2_predicted	solute carrier family 25 (mitochondrial carrier, ornithine transporter) member 2 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - SMPDB

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - SMPDB