Apoh (apolipoprotein H) - Rat Genome Database

Name: Apoh
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Apoh (apolipoprotein H) Rattus norvegicus

Analyze

Symbol:

Apoh

Name:

apolipoprotein H

RGD ID:

1310625

Description:

Enables lipid binding activity. Involved in several processes, including negative regulation of respiratory burst; positive regulation of triglyceride catabolic process; and triglyceride transport. Located in cell surface and extracellular space. Used to study myocardial infarction and thrombosis. Human ortholog(s) of this gene implicated in antiphospholipid syndrome; myocardial infarction; and peripheral vascular disease. Orthologous to human APOH (apolipoprotein H); PARTICIPATES IN coagulation cascade pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

apo-H; apolipoprotein H (beta-2-glycoprotein I); B2GPI; beta(2)GPI; beta-2-glycoprotein 1; beta-2-glycoprotein I; LOC287774

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	APOH (apolipoprotein H)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Apoh (apolipoprotein H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Apoh (apolipoprotein H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	APOH (apolipoprotein H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	APOH (apolipoprotein H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Apoh (apolipoprotein H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	APOH (apolipoprotein H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	APOH (apolipoprotein H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Apoh (apolipoprotein H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	APOH (apolipoprotein H)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Apoh (apolipoprotein H)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ntd5 (ntl-dependent gene 5)	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG9095	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	apoh	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	93,841,992 - 93,855,897 (+)	NCBI		GRCr8
mRatBN7.2	10	93,342,435 - 93,356,334 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	93,310,977 - 93,356,329 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	98,400,040 - 98,413,944 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	97,863,118 - 97,877,037 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	93,267,097 - 93,280,941 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	96,640,013 - 96,653,939 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	96,639,924 - 96,653,938 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	96,364,217 - 96,378,118 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	97,725,088 - 97,739,213 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	97,739,457 - 97,753,582 (+)	NCBI
Celera	10	92,007,324 - 92,020,973 (+)	NCBI		Celera
Cytogenetic Map	10	q32.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

antiphospholipid syndrome (ISO)

arteriosclerosis (ISO)

Chemical and Drug Induced Liver Injury (IEP,ISO)

diabetes mellitus (ISO)

Diabetic Nephropathies (ISO)

diabetic retinopathy (ISO)

Fetal Growth Retardation (ISO)

Fetal Resorption (ISO)

Hyperlipoproteinemias (ISO)

macular retinal edema (ISO)

metabolic dysfunction-associated steatotic liver disease (ISO)

myocardial infarction (IDA,ISO)

peripheral vascular disease (ISO)

Pregnancy in Diabetics (ISO)

Stroke (ISO)

thrombosis (IDA)

type 1 diabetes mellitus (ISO)

type 2 diabetes mellitus (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-methoxyethanol (EXP)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

amiodarone (EXP)

ammonium chloride (EXP)

aristolochic acid A (EXP)

arsane (ISO)

arsenic atom (ISO)

atrazine (EXP)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bromobenzene (EXP)

buta-1,3-diene (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carnosic acid (ISO)

CGP 52608 (ISO)

chenodeoxycholic acid (ISO)

cisplatin (ISO)

clofibrate (EXP)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cordycepin (ISO)

cyclophosphamide (EXP)

cyclosporin A (ISO)

dicrotophos (ISO)

diisopropyl fluorophosphate (EXP)

diquat (ISO)

dorsomorphin (ISO)

gamma-linolenic acid (ISO)

gemcitabine (ISO)

iron atom (EXP)

iron(0) (EXP)

L-ethionine (EXP)

menadione (ISO)

methidathion (ISO)

N,N-diethyl-m-toluamide (EXP)

N-nitrosomorpholine (EXP)

nitrofen (EXP)

O-methyleugenol (ISO)

olanzapine (ISO)

omeprazole (EXP)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

permethrin (EXP)

pirinixic acid (EXP)

potassium dichromate (ISO)

propanal (ISO)

quercetin (ISO)

S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP)

SB 431542 (ISO)

senecionine (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

succimer (ISO)

tetrachloromethane (EXP)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triptonide (ISO)

valproic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

animal organ regeneration (IMP)

blood coagulation, intrinsic pathway (ISO)

negative regulation of angiogenesis (ISO)

negative regulation of blood coagulation (ISO)

negative regulation of endothelial cell migration (ISO)

negative regulation of endothelial cell proliferation (ISO)

negative regulation of fibrinolysis (ISO)

negative regulation of myeloid cell apoptotic process (ISO)

negative regulation of respiratory burst (IDA)

negative regulation of smooth muscle cell apoptotic process (ISO)

plasminogen activation (ISO)

positive regulation of lipoprotein lipase activity (ISO)

positive regulation of triglyceride catabolic process (IDA)

regulation of blood coagulation (ISO)

regulation of fibrinolysis (ISO)

response to triglyceride (IEP)

triglyceride metabolic process (ISO)

triglyceride transport (IDA)

Cellular Component

cell surface (IDA,ISO)

chylomicron (ISO)

extracellular space (IDA,ISO)

high-density lipoprotein particle (ISO)

very-low-density lipoprotein particle (ISO)

Molecular Function

heparin binding (IEA)

identical protein binding (ISO)

lipid binding (IDA,ISO)

lipoprotein lipase activator activity (ISO)

phospholipid binding (ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

coagulation cascade pathway (ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	A non-complement-fixing antibody to beta2 glycoprotein I as a novel therapy for antiphospholipid syndrome.	Agostinis C, etal., Blood. 2014 May 29;123(22):3478-87. doi: 10.1182/blood-2013-11-537704. Epub 2014 Mar 18.
2.	Beta2-glycoprotein I-dependent and -independent anticardiolipin antibody in non-obese diabetic (NOD) mice.	Anzai K, etal., Clin Exp Immunol. 1998 Jan;111(1):173-80.
3.	Beta-2-glycoprotein I is growth regulated and plays a role as survival factor for hepatocytes.	Averna M, etal., Int J Biochem Cell Biol. 2004 Jul;36(7):1297-305.
4.	Relation of preexisting anti-beta2GPI antibodies to infarct size in a rat model.	Barshack I, etal., Cardiovasc Pathol. 2003 Jul-Aug;12(4):195-201.
5.	Anti-beta 2-glycoprotein I antibodies bind to central nervous system.	Caronti B, etal., J Neurol Sci. 1998 Apr 1;156(2):211-9.
6.	Apolipoprotein H is increased in type 2 diabetic patients with microalbuminuria.	Cavallo Perin P, etal., Nutr Metab Cardiovasc Dis. 2000 Dec;10(6):311-4.
7.	Thrombus formation induced by antibodies to beta2-glycoprotein I is complement dependent and requires a priming factor.	Fischetti F, etal., Blood. 2005 Oct 1;106(7):2340-6. Epub 2005 Jun 14.
8.	Autoantibodies to the atheroma component beta2-glycoprotein I and risk of symptomatic peripheral artery disease.	Franck M, etal., Angiology. 2007 Jun-Jul;58(3):295-302.
9.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
10.	beta 2-glycoprotein I (apolipoprotein H) modulates uptake and endocytosis associated chemiluminescence in rat Kupffer cells.	Gomes LF, etal., Free Radic Res. 2002 Jul;36(7):741-7.
11.	Oxidized low-density lipoprotein/beta2-glycoprotein I complexes and autoantibodies in patients with type 2 diabetes mellitus.	Lopez LR, etal., Ann N Y Acad Sci. 2005 Jun;1051:97-103.
12.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
13.	Beta 2 glycoprotein I--function in health and disease.	Miyakis S, etal., Thromb Res. 2004;114(5-6):335-46.
14.	[Beta 2 glycoprotein I analysis in patients with hyperlipoproteinemia, arteriosclerotic occlusive disease and diabetes mellitus]	Muller G, etal., Z Gesamte Inn Med. 1983 May 15;38(10):282-4.
15.	Identification of novel liver-specific mRNAs in plasma for biomarkers of drug-induced liver injury and quantitative evaluation in rats treated with various hepatotoxic compounds.	Okubo S, etal., Toxicol Sci. 2013 Mar;132(1):21-31. doi: 10.1093/toxsci/kfs340. Epub 2013 Jan 3.
16.	Proteomic analysis of vitreous from diabetic macular edema.	Ouchi M, etal., Exp Eye Res. 2005 Aug;81(2):176-82.
17.	Investigations on beta 2-glycoprotein-I in the rat: isolation from serum and demonstration in lipoprotein density fractions.	Polz E, etal., Int J Biochem. 1980;11(3-4):265-70.
18.	Anti-beta2-glycoprotein I antibodies as risk factors for acute myocardial infarction.	Ranzolin A, etal., Arq Bras Cardiol. 2004 Aug;83(2):141-4; 137-40. Epub 2004 Aug 17.
19.	GOA pipeline	RGD automated data pipeline
20.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
21.	Influence of APOH protein polymorphism on apoH levels in normal and diabetic subjects.	Ruiu G, etal., Clin Genet. 1997 Sep;52(3):167-72.
22.	Dietary oil modifies the plasma proteome during aging in the rat.	Santos-Gonzalez M, etal., Age (Dordr). 2011 Apr 7.
23.	Elevation of apolipoprotein A-I and apolipoprotein H levels in the vitreous fluid and overexpression in the retina of diabetic patients.	Simo R, etal., Arch Ophthalmol. 2008 Aug;126(8):1076-81.
24.	Antibodies to the atherosclerotic plaque components beta2-glycoprotein I and heat-shock proteins as risk factors for acute cerebral ischemia.	Staub HL, etal., Arq Neuropsiquiatr. 2003 Sep;61(3B):757-63. Epub 2003 Oct 28.
25.	Beta 2-glycoprotein I is a good indicator of certain adverse pregnancy conditions.	Ulcova-Gallova Z, etal., Int J Fertil Womens Med. 2001 Nov-Dec;46(6):304-8.
26.	Studies on the possible function of beta 2-glycoprotein-I: influence in the triglyceride metabolism in the rat.	Wurm H, etal., Metabolism. 1982 May;31(5):484-6.
27.	The role of beta2-glycoprotein I in liposome-hepatocyte interaction.	Yan X, etal., Biochim Biophys Acta. 2004 Dec 15;1667(2):208-14.

Additional References at PubMed

PMID:222615	PMID:2771654	PMID:4052628	PMID:7417307	PMID:11145969	PMID:12477932	PMID:14726399	PMID:15486070	PMID:15534879	PMID:16480936	PMID:16502470	PMID:17872974
PMID:18822289	PMID:19805618	PMID:19895376	PMID:20551380	PMID:23376485	PMID:23533145	PMID:27068509	PMID:27559042	PMID:30442725

Genomics

Comparative Map Data

Apoh
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	93,841,992 - 93,855,897 (+)	NCBI		GRCr8
mRatBN7.2	10	93,342,435 - 93,356,334 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	93,310,977 - 93,356,329 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	98,400,040 - 98,413,944 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	97,863,118 - 97,877,037 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	93,267,097 - 93,280,941 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	96,640,013 - 96,653,939 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	96,639,924 - 96,653,938 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	96,364,217 - 96,378,118 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	97,725,088 - 97,739,213 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	97,739,457 - 97,753,582 (+)	NCBI
Celera	10	92,007,324 - 92,020,973 (+)	NCBI		Celera
Cytogenetic Map	10	q32.1	NCBI

APOH
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	66,212,033 - 66,229,415 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	66,212,033 - 66,256,525 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	64,208,151 - 64,225,533 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	61,638,609 - 61,656,018 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	61,638,613 - 61,655,992	NCBI
Celera	17	60,780,183 - 60,797,591 (-)	NCBI		Celera
Cytogenetic Map	17	q24.2	NCBI
HuRef	17	59,599,926 - 59,617,004 (-)	NCBI		HuRef
CHM1_1	17	64,272,419 - 64,289,828 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	67,082,811 - 67,100,218 (-)	NCBI		T2T-CHM13v2.0

Apoh
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	108,286,123 - 108,305,222 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	108,234,180 - 108,305,222 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	108,395,297 - 108,414,396 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	108,343,354 - 108,414,396 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	108,256,611 - 108,275,710 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	108,211,403 - 108,230,481 (+)	NCBI		MGSCv36	mm8
Celera	11	120,134,821 - 120,148,689 (+)	NCBI		Celera
Cytogenetic Map	11	E1	NCBI
cM Map	11	71.8	NCBI

Apoh
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955478	5,610,164 - 5,626,020 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955478	5,612,258 - 5,626,061 (-)	NCBI	ChiLan1.0	ChiLan1.0

APOH
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	82,247,480 - 82,339,338 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	87,066,978 - 87,158,996 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	60,154,389 - 60,171,762 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	65,365,250 - 65,382,483 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	65,365,250 - 65,382,483 (-)	Ensembl	panpan1.1		panPan2

APOH
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	14,082,648 - 14,095,186 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	14,082,541 - 14,095,185 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	14,976,443 - 14,988,978 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	15,744,714 - 15,757,283 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	15,744,709 - 15,757,972 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	14,691,324 - 14,703,853 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	12,829,414 - 12,841,962 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	12,830,254 - 12,842,800 (-)	NCBI		UU_Cfam_GSD_1.0

Apoh
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	12,499,435 - 12,511,134 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936541	6,683,534 - 6,695,066 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936541	6,683,483 - 6,695,094 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

APOH
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	12,827,201 - 12,839,175 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	12,827,195 - 12,839,172 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	13,142,347 - 13,154,323 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

APOH
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	55,209,142 - 55,231,176 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666077	26,257,256 - 26,290,880 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Apoh
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624870	2,081,968 - 2,099,517 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624870	2,082,050 - 2,096,220 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Apoh
106 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	71
Count of miRNA genes:	65
Interacting mature miRNAs:	68
Transcripts:	ENSRNOT00000004756
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
1354641	Bvd2	Brain ventricular dilatation QTL 2	6.36	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	10	93223816	107057807	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	57576521	102576521	Rat
1579915	Bp280	Blood pressure QTL 280		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90404397	107211142	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	53797494	98952626	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	72224939	107211142	Rat
1579919	Bp281	Blood pressure QTL 281		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	74372084	94965338	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76452683	107211142	Rat
1300107	Rf18	Renal function QTL 18	3.41		urine output (VT:0003620)	timed urine volume (CMO:0000260)	10	78775516	98279596	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	82685200	107211142	Rat
70168	Eae12	Experimental allergic encephalomyelitis QTL 12		0.0009	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	92238497	101012337	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
10450495	Bp383	Blood pressure QTL 383		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	94965338	Rat
2313856	Bp342	Blood pressure QTL 342	4.4	0.0001	life span trait (VT:0005372)	age at time of death (CMO:0001193)	10	87307617	96121100	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2292617	Ept18	Estrogen-induced pituitary tumorigenesis QTL 18	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73453136	96120911	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2293646	Bss25	Bone structure and strength QTL 25	10.96	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	10	69738412	107211142	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
2300172	Bmd57	Bone mineral density QTL 57	9.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	10	69738412	107211142	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72224939	107211142	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
61363	Oia3	Oil induced arthritis QTL 3		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87307617	107211142	Rat
1357344	Bp249	Blood pressure QTL 249		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	66743655	98003205	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
2306970	Anxrr22	Anxiety related response QTL 22	5.95		fear/anxiety-related behavior trait (VT:1000241)	number of periods of voluntary immobility (CMO:0001045)	10	61345276	98211570	Rat
724530	Bp149	Blood pressure QTL 149		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90627439	107211142	Rat
1300137	Bp186	Blood pressure QTL 186	3.57		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	10	90627439	107057807	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
2293663	Bss33	Bone structure and strength QTL 33	9.34	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	10	69738412	107211142	Rat
2312672	Insul15	Insulin level QTL 15		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	10	57134272	102134272	Rat
6893357	Bw102	Body weight QTL 102	0.5	0.36	body mass (VT:0001259)	body weight (CMO:0000012)	10	80515287	101325465	Rat
12880384	Cm107	Cardiac mass QTL 107		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)		90404397	107211142	Rat
12880385	Cm108	Cardiac mass QTL 108		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)		90404397	107211142	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	66978955	107211142	Rat
2303589	Bw87	Body weight QTL 87	2		body mass (VT:0001259)	body weight (CMO:0000012)	10	81285008	107211142	Rat
12880396	Am13	Aortic mass QTL 13		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	90404397	107211142	Rat
2306793	Ean5	Experimental allergic neuritis QTL 5	4.7		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	72552416	93995749	Rat
12880398	Kidm67	Kidney mass QTL 67		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	90404397	107211142	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
2306792	Ean4	Experimental allergic neuritis QTL 4	4		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	84022321	93995963	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	66978955	107211142	Rat
12880395	Cm109	Cardiac mass QTL 109		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	90404397	107211142	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68420376	107211142	Rat
634320	Niddm49	Non-insulin dependent diabetes mellitus QTL 49	4.41		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	10	88539139	107211142	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
10450498	Bp384	Blood pressure QTL 384		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	67750049	107211142	Rat
4889492	Pancm2	Pancreatic morphology QTL 2	3.2		pancreatic beta cell morphology trait (VT:0005217)	ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814)	10	76748906	107211142	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70199100	107211142	Rat
2293698	Bss43	Bone structure and strength QTL 43	5.33	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	10	59209888	104209888	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	54809292	99809292	Rat
1558643	Cm44	Cardiac mass QTL 44	4.8	0.0000368	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	61345276	99703528	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
6893336	Cm75	Cardiac mass QTL 75	0.1	0.87	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	61345276	99703528	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
12880055	Am11	Aortic mass QTL 11		0.004	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	84007272	95933025	Rat
2292438	Bp311	Blood pressure QTL 311			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	107211142	Rat
2312662	Slep8	Serum leptin concentration QTL 8		0.05	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	10	57134272	102134272	Rat
2301398	Kidm38	Kidney mass QTL 38		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	84007272	95933025	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	85565469	103884409	Rat
1358188	Ept9	Estrogen-induced pituitary tumorigenesis QTL 9	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73453136	96120911	Rat
631538	Oia5	Oil induced arthritis QTL 5			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87055121	107211142	Rat
61436	Cia5	Collagen induced arthritis QTL 5	4.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	91228102	104060283	Rat
1642980	Bp300	Blood pressure QTL 300			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68383129	107211142	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
2312668	Scl65	Serum cholesterol level QTL 65		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	57134272	102134272	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	10	21	98	87	86	59	22	59	5	179	62	81	41	55	27

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001009626	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AM071386	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088180	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209412	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209458	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209491	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209629	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209740	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210182	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210311	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210756	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210813	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211328	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218065	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218068	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218335	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218433	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218445	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218454	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218597	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218599	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218637	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218785	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218859	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218865	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218868	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219138	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219305	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219328	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219380	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219438	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219481	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219537	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219580	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219601	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219674	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219740	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000004756 ⟹ ENSRNOP00000004756

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	93,310,977 - 93,356,329 (+)	Ensembl
Rnor_6.0 Ensembl	10	96,639,924 - 96,653,938 (+)	Ensembl

RefSeq Acc Id:

NM_001009626 ⟹ NP_001009626

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	93,841,992 - 93,855,897 (+)	NCBI
mRatBN7.2	10	93,342,435 - 93,356,334 (+)	NCBI
Rnor_6.0	10	96,640,013 - 96,653,939 (+)	NCBI
Rnor_5.0	10	96,364,217 - 96,378,118 (+)	NCBI
RGSC_v3.4	10	97,725,088 - 97,739,213 (+)	RGD
Celera	10	92,007,324 - 92,020,973 (+)	RGD

Sequence:

show sequence

CATCTACAATGATTTCTCCGGCGCTCATCTTCTTTTCTGCCTTCCTCTGCCATGTTGCTATTGC
GGGACGGACCTGTCCGAAGCCGGATGAACTACCGTTTGCTGTGGTTGTTCCCTTAAAAACATTC
TATGACCCAGGGGAGCAGATTGTCTATTCCTGCAAGCCAGGCTATGTGTCCAGGGGAGGGATGA
GACGGTTTACCTGTCCTCTCACAGGGATGTGGCCCATCAACACCCTGAAATGTATACCCAGAGT
GTGTCCTTTTGCCGGAATCTTAGAAAATGGAGTTGTACGCTACACGACTTTTGAATATCCCAAC
ACCATTGGCTTTGCTTGTAACCCTGGGTATTATCTGAACGGGACTAGCTCTTCTAAGTGCACGG
AGGAAGGAAAATGGAGTCCAGAACTTCCTGTTTGTGCTCGGATCACCTGCCCGCCACCACCAAT
TCCTAAGTTTGCAGCCCTTAAGGAATACAAGACTTCAGTTGGGAACAGCTCTTTTTATCAGGAC
ACAGTGGTCTTTAAATGCTTGCCACACTTTGCCATGTTTGGAAATGACACAGTTACGTGCACAG
CCCATGGAAACTGGACCCAATTGCCAGAATGCCGGGAAGTAAAATGTCCCTTCCCTTCAAGGCC
AGACAATGGGTTTGTGAATTACCCTGCAAAGCCGGTGCTTTCTTATAAAGATAAAGCCGTATTT
GGTTGCCATGAAACATACAAACTGGATGGCCCGGAAGAAGTGGAGTGTACCAAGACAGGAAATT
GGTCGGCCCTGCCGAGCTGTAAAGCATCTTGCAAACTCTCTGTTAAGAAGGCCACCGTGTTGTA
CCAAGGGCAGAGGGTGAAGATCCAGGACCAGTTTAAGAATGGGATGATGCATGGTGACAAGGTT
CACTTCTATTGTAAAAATAAGGAGAAGAAGTGCAGCTACACCGAGGAGGCTCAGTGCATAGACG
GCACCATCGAGATCCCCAAATGCTTCAAGGAGCACAGTTCTCTGGCTTTCTGGAAAACGGATGC
ATCAGATGTGACACCGTGCTGAAGACATTTTCAGAATCAAAATTGAATGTCTCATTTGTATCTC
TGCTTGTCTGAGGAATCAACTGAAATAGCAGAATAAACTACCGAGTTGCCTCAGTCAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001009626	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88180	(Get FASTA)	NCBI Sequence Viewer
	CAJ29887	(Get FASTA)	NCBI Sequence Viewer
	EDM06447	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004756.4
GenBank Protein	P26644	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001009626 ⟸ NM_001009626
- Peptide Label:	precursor
- UniProtKB:	P26644 (UniProtKB/Swiss-Prot), Q5I0M1 (UniProtKB/TrEMBL), A6HK92 (UniProtKB/TrEMBL), F7FC04 (UniProtKB/TrEMBL)
- Sequence:	show sequence MISPALIFFSAFLCHVAIAGRTCPKPDELPFAVVVPLKTFYDPGEQIVYSCKPGYVSRGGMRRF TCPLTGMWPINTLKCIPRVCPFAGILENGVVRYTTFEYPNTIGFACNPGYYLNGTSSSKCTEEG KWSPELPVCARITCPPPPIPKFAALKEYKTSVGNSSFYQDTVVFKCLPHFAMFGNDTVTCTAHG NWTQLPECREVKCPFPSRPDNGFVNYPAKPVLSYKDKAVFGCHETYKLDGPEEVECTKTGNWSA LPSCKASCKLSVKKATVLYQGQRVKIQDQFKNGMMHGDKVHFYCKNKEKKCSYTEEAQCIDGTI EIPKCFKEHSSLAFWKTDASDVTPC hide sequence

Ensembl Acc Id:

ENSRNOP00000004756 ⟸ ENSRNOT00000004756

Protein Domains

Sushi

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P26644-F1-model_v2	AlphaFold	P26644	1-297	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697854

Promoter ID:

EPDNEW_R8379

Type:

initiation region

Name:

Apoh_1

Description:

apolipoprotein H

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	96,639,990 - 96,640,050	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310625	AgrOrtholog
BioCyc Gene	G2FUF-22879	BioCyc
Ensembl Genes	ENSRNOG00000003566	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000004756.8	UniProtKB/TrEMBL
Gene3D-CATH	Complement Module, domain 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7364928	IMAGE-MGC_LOAD
InterPro	Compl-Cell_Adhes-Reg	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Sushi/SCR/CCP_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Sushi_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Sushi_SCR_CCP_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:287774	UniProtKB/TrEMBL
MGC_CLONE	MGC:108825	IMAGE-MGC_LOAD
NCBI Gene	287774	ENTREZGENE
PANTHER	C4B-BINDING PROTEIN BETA CHAIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	COMPLEMENT COMPONENT-RELATED SUSHI DOMAIN-CONTAINING	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	LOCOMOTION-RELATED PROTEIN HIKARU GENKI	UniProtKB/TrEMBL
Pfam	Sushi	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Sushi_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Apoh	PhenoGen
PROSITE	SUSHI	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000003566	RatGTEx
SMART	CCP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF57535	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6HK92	ENTREZGENE, UniProtKB/TrEMBL
	APOH_RAT	UniProtKB/Swiss-Prot
	F7FC04	ENTREZGENE, UniProtKB/TrEMBL
	P26644	ENTREZGENE
	Q3T940_RAT	UniProtKB/TrEMBL
	Q5I0M1	ENTREZGENE
UniProt Secondary	Q5I0M1	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-23	Apoh	apolipoprotein H	Apoh	apolipoprotein H (beta-2-glycoprotein I)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Apoh	apolipoprotein H (beta-2-glycoprotein I)	Apoh	apolipoprotein H	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Apoh	apolipoprotein H	Apoh_predicted	apolipoprotein H (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Apoh_predicted	apolipoprotein H (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - CTD

RGD Manual Annotations