Advanced Search (OLGA)

Gene: Gbp4 (guanylate binding protein 4) Rattus norvegicus

Analyze

Symbol:

Gbp4

Name:

guanylate binding protein 4

RGD ID:

1310579

Description:

Predicted to enable GTP binding activity; GTPase activity; and protein homodimerization activity. Predicted to be involved in several processes, including cellular response to lipopolysaccharide; defense response to other organism; and positive regulation of defense response. Predicted to act upstream of or within adhesion of symbiont to host and cellular response to interferon-beta. Predicted to be located in several cellular components, including Golgi apparatus; cytosol; and perinuclear region of cytoplasm. Predicted to be active in cytoplasmic vesicle. Orthologous to human GBP4 (guanylate binding protein 4); INTERACTS WITH 1,3-dinitrobenzene; 1-naphthyl isothiocyanate; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Gbp3; guanylate nucleotide binding protein 3; guanylate nucleotide binding protein 4; guanylate-binding protein 4; guanylate-binding protein 4-like; LOC100911495; LOC310917

RGD Orthologs

Human

Mouse

Bonobo

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GBP4 (guanylate binding protein 4)	RGD	RGD
Mus musculus (house mouse):	Gbp3 (guanylate binding protein 3)	RGD	RGD
Pan paniscus (bonobo/pygmy chimpanzee):	GBP7 (guanylate binding protein 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GBP7 (guanylate binding protein 7)	HGNC	Inparanoid, OrthoDB, Panther, PhylomeDB, Treefam
Homo sapiens (human):	GBP6 (guanylate binding protein family member 6)	HGNC	OrthoDB, Panther
Alliance orthologs ³
Homo sapiens (human):	GBP4 (guanylate binding protein 4)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gbp3 (guanylate binding protein 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	GBP7 (guanylate binding protein 7)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gbp3 (guanylate binding protein 3)	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	gbp2 (guanylate binding protein 2)	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	si:dkeyp-30d6.2	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	si:dkeyp-30d6.2	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	gbp1 (guanylate binding protein 1)	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	gbp6	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	gbp1	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	gbp7	Alliance	DIOPT (OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	233,978,163 - 233,992,124 (+)	NCBI		GRCr8
mRatBN7.2	2	231,304,910 - 231,318,883 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	231,305,244 - 231,318,879 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	239,078,909 - 239,092,524 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	236,973,203 - 236,986,820 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	231,836,590 - 231,850,207 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	248,249,232 - 248,263,104 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	248,249,468 - 248,263,168 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	266,777,820 - 266,791,543 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	240,495,963 - 240,509,393 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	240,453,144 - 240,495,609 (+)	NCBI
Celera	2	223,352,892 - 223,366,524 (+)	NCBI		Celera
Cytogenetic Map	2	q44	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gbp4	Rat	Experimental Liver Cirrhosis		ISO	RGD:1321567	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:25380136

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gbp4	Rat	(-)-demecolcine	increases expression	ISO	RGD:1321567	6480464	Demecolcine results in increased expression of GBP4 mRNA	CTD	PMID:23649840
Gbp4	Rat	(-)-epigallocatechin 3-gallate	multiple interactions	ISO	RGD:1321567	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of GBP4 mRNA	CTD	PMID:22079256
Gbp4	Rat	1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene	multiple interactions	ISO	RGD:1553529	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Gbp4	Rat	1,2-dichloroethane	decreases expression	ISO	RGD:1553529	6480464	ethylene dichloride results in decreased expression of GBP3 mRNA	CTD	PMID:28960355
Gbp4	Rat	1,3-dinitrobenzene	increases expression	EXP		6480464	3-dinitrobenzene results in increased expression of GBP4 mRNA	CTD	PMID:21983209
Gbp4	Rat	1-naphthyl isothiocyanate	increases expression	EXP		6480464	1-Naphthylisothiocyanate results in increased expression of GBP4 mRNA	CTD	PMID:25380136
Gbp4	Rat	17beta-estradiol	multiple interactions	ISO	RGD:1321567	6480464	[Estradiol co-treated with TGFB1 protein] results in decreased expression of GBP4 mRNA	CTD	PMID:30165855
Gbp4	Rat	17beta-estradiol	decreases expression	ISO	RGD:1553529	6480464	Estradiol results in decreased expression of GBP3 mRNA; Estradiol results in decreased expression of GBP4 more ...	CTD	PMID:39298647
Gbp4	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of GBP4 mRNA	CTD	PMID:32741896
Gbp4	Rat	17beta-estradiol 3-benzoate	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of GBP4 mRNA	CTD	PMID:32741896
Gbp4	Rat	2,2',4,4',5,5'-hexachlorobiphenyl	multiple interactions	ISO	RGD:1553529	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Gbp4	Rat	2,2',5,5'-tetrachlorobiphenyl	multiple interactions	ISO	RGD:1553529	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Gbp4	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of GBP4 mRNA	CTD	PMID:22298810
Gbp4	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of GBP4 mRNA	CTD	PMID:33387578
Gbp4	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1553529	6480464	Tetrachlorodibenzodioxin affects the expression of GBP3 mRNA; Tetrachlorodibenzodioxin affects the expression of GBP4 mRNA	CTD	PMID:21570461\|PMID:26377647
Gbp4	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1553529	6480464	Tetrachlorodibenzodioxin results in decreased expression of GBP4 mRNA	CTD	PMID:25975270
Gbp4	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1321567	6480464	Tetrachlorodibenzodioxin affects the expression of GBP4 mRNA	CTD	PMID:22298810
Gbp4	Rat	2,4,4'-trichlorobiphenyl	multiple interactions	ISO	RGD:1553529	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Gbp4	Rat	2,4,6-trinitrobenzenesulfonic acid	increases expression	ISO	RGD:1553529	6480464	Trinitrobenzenesulfonic Acid results in increased expression of GBP3 mRNA	CTD	PMID:17982090
Gbp4	Rat	4,4'-diaminodiphenylmethane	decreases expression	ISO	RGD:1553529	6480464	4,4'-diaminodiphenylmethane results in decreased expression of GBP3 mRNA	CTD	PMID:18648102
Gbp4	Rat	4,4'-diaminodiphenylmethane	increases expression	EXP		6480464	4,4'-diaminodiphenylmethane results in increased expression of GBP4 mRNA	CTD	PMID:25380136\|PMID:30723492
Gbp4	Rat	4,4'-sulfonyldiphenol	affects expression	ISO	RGD:1553529	6480464	bisphenol S affects the expression of GBP3 mRNA	CTD	PMID:39298647
Gbp4	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1553529	6480464	bisphenol S results in increased expression of GBP4 mRNA	CTD	PMID:33297965
Gbp4	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	RGD:1553529	6480464	bisphenol S results in decreased expression of GBP4 mRNA	CTD	PMID:39298647
Gbp4	Rat	4-hydroxynon-2-enal	decreases expression	ISO	RGD:1553529	6480464	4-hydroxy-2-nonenal results in decreased expression of GBP3 mRNA	CTD	PMID:19191707
Gbp4	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:1553529	6480464	Fenretinide results in increased expression of GBP3 mRNA	CTD	PMID:28973697
Gbp4	Rat	4-hydroxyphenyl retinamide	decreases expression	ISO	RGD:1553529	6480464	Fenretinide results in decreased expression of GBP3 mRNA	CTD	PMID:28973697
Gbp4	Rat	6-propyl-2-thiouracil	multiple interactions	ISO	RGD:1553529	6480464	[Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of GBP3 mRNA	CTD	PMID:36706583
Gbp4	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of GBP4 mRNA	CTD	PMID:31881176
Gbp4	Rat	aflatoxin B1	decreases methylation	ISO	RGD:1321567	6480464	Aflatoxin B1 results in decreased methylation of GBP4 gene	CTD	PMID:27153756
Gbp4	Rat	aldehydo-D-glucose	multiple interactions	ISO	RGD:1553529	6480464	[lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ...	CTD	PMID:37567420
Gbp4	Rat	all-trans-retinoic acid	increases expression	ISO	RGD:1321567	6480464	Tretinoin results in increased expression of GBP4 mRNA	CTD	PMID:23830798\|PMID:33167477
Gbp4	Rat	aluminium atom	decreases expression	ISO	RGD:1553529	6480464	Aluminum results in decreased expression of GBP3 mRNA	CTD	PMID:37544489
Gbp4	Rat	aluminium(0)	decreases expression	ISO	RGD:1553529	6480464	Aluminum results in decreased expression of GBP3 mRNA	CTD	PMID:37544489
Gbp4	Rat	antirheumatic drug	decreases expression	ISO	RGD:1321567	6480464	Antirheumatic Agents results in decreased expression of GBP4 mRNA	CTD	PMID:24449571
Gbp4	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1553529	6480464	Benzo(a)pyrene results in decreased expression of GBP3 mRNA	CTD	PMID:21569818
Gbp4	Rat	benzo[a]pyrene	decreases methylation	ISO	RGD:1321567	6480464	Benzo(a)pyrene results in decreased methylation of GBP4 exon	CTD	PMID:27901495
Gbp4	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1553529	6480464	Benzo(a)pyrene results in increased expression of GBP3 mRNA; Benzo(a)pyrene results in increased expression of GBP4 more ...	CTD	PMID:22610609\|PMID:23735875
Gbp4	Rat	benzo[a]pyrene	increases mutagenesis	ISO	RGD:1321567	6480464	Benzo(a)pyrene results in increased mutagenesis of GBP4 gene	CTD	PMID:25435355
Gbp4	Rat	benzoates	decreases expression	ISO	RGD:1321567	6480464	Benzoates analog results in decreased expression of GBP4 mRNA	CTD	PMID:29472718
Gbp4	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1553529	6480464	Diethylhexyl Phthalate results in increased expression of GBP4 mRNA	CTD	PMID:28085963
Gbp4	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of GBP4 mRNA	CTD	PMID:25181051
Gbp4	Rat	bisphenol A	increases expression	ISO	RGD:1553529	6480464	bisphenol A results in increased expression of GBP3 mRNA	CTD	PMID:32156529
Gbp4	Rat	bisphenol A	decreases expression	ISO	RGD:1553529	6480464	bisphenol A results in decreased expression of GBP4 mRNA	CTD	PMID:35598803
Gbp4	Rat	bisphenol A	multiple interactions	ISO	RGD:1321567	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of GBP4 gene	CTD	PMID:31601247
Gbp4	Rat	bisphenol F	increases expression	ISO	RGD:1553529	6480464	bisphenol F results in increased expression of GBP4 mRNA	CTD	PMID:30951980
Gbp4	Rat	cadmium dichloride	increases expression	EXP		6480464	Cadmium Chloride results in increased expression of GBP4 mRNA	CTD	PMID:25993096
Gbp4	Rat	cantharidin	decreases expression	ISO	RGD:1553529	6480464	Cantharidin results in decreased expression of GBP4 mRNA	CTD	PMID:36907384
Gbp4	Rat	carbon nanotube	affects expression	ISO	RGD:1553529	6480464	Nanotubes, Carbon affects the expression of GBP3 mRNA; Nanotubes, Carbon analog affects the expression of more ...	CTD	PMID:25554681
Gbp4	Rat	carbon nanotube	increases expression	ISO	RGD:1321567	6480464	Nanotubes, Carbon results in increased expression of GBP4 mRNA	CTD	PMID:29348435
Gbp4	Rat	carbon nanotube	decreases expression	ISO	RGD:1553529	6480464	Nanotubes, Carbon analog results in decreased expression of GBP3 mRNA; Nanotubes, Carbon analog results in more ...	CTD	PMID:25554681\|PMID:25620056
Gbp4	Rat	CGP 52608	multiple interactions	ISO	RGD:1321567	6480464	CGP 52608 promotes the reaction [RORA protein binds to GBP4 gene]	CTD	PMID:28238834
Gbp4	Rat	chloroprene	decreases expression	ISO	RGD:1553529	6480464	Chloroprene results in decreased expression of GBP3 mRNA	CTD	PMID:23125180
Gbp4	Rat	chlorpyrifos	increases expression	ISO	RGD:1553529	6480464	Chlorpyrifos results in increased expression of GBP4 mRNA	CTD	PMID:37019170
Gbp4	Rat	cholesterol	multiple interactions	ISO	RGD:1553529	6480464	[Cholesterol co-treated with 1,2-dioleoyloxy-3-(trimethylammonium)propane] results in increased expression of GBP4 mRNA	CTD	PMID:22129739
Gbp4	Rat	copper atom	multiple interactions	ISO	RGD:1321567	6480464	[Disulfiram binds to Copper] which results in increased expression of GBP4 mRNA	CTD	PMID:24690739
Gbp4	Rat	copper(0)	multiple interactions	ISO	RGD:1321567	6480464	[Disulfiram binds to Copper] which results in increased expression of GBP4 mRNA	CTD	PMID:24690739
Gbp4	Rat	corosolic acid	decreases expression	ISO	RGD:1321567	6480464	corosolic acid results in decreased expression of GBP4 mRNA	CTD	PMID:37939859
Gbp4	Rat	cyclophosphamide	increases expression	ISO	RGD:1553529	6480464	Cyclophosphamide results in increased expression of GBP3 mRNA	CTD	PMID:15331540
Gbp4	Rat	cytarabine	decreases expression	ISO	RGD:1321567	6480464	Cytarabine results in decreased expression of GBP4 mRNA	CTD	PMID:21198554
Gbp4	Rat	D-glucose	multiple interactions	ISO	RGD:1553529	6480464	[lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ...	CTD	PMID:37567420
Gbp4	Rat	dextran sulfate	multiple interactions	ISO	RGD:1553529	6480464	evodiamine inhibits the reaction [Dextran Sulfate results in decreased expression of GBP4 protein]	CTD	PMID:35362542
Gbp4	Rat	dextran sulfate	decreases expression	ISO	RGD:1553529	6480464	Dextran Sulfate results in decreased expression of GBP4 protein	CTD	PMID:35362542
Gbp4	Rat	dibenz[a,h]anthracene	increases expression	ISO	RGD:1553529	6480464	1,2,5,6-dibenzanthracene results in increased expression of GBP4 mRNA	CTD	PMID:26377693
Gbp4	Rat	diclofenac	increases expression	ISO	RGD:1553529	6480464	Diclofenac results in increased expression of GBP3 mRNA	CTD	PMID:26934552
Gbp4	Rat	diiodine	multiple interactions	ISO	RGD:1553529	6480464	[Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of GBP3 mRNA	CTD	PMID:36706583
Gbp4	Rat	dimethylarsinic acid	multiple interactions	ISO	RGD:1553529	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ...	CTD	PMID:34876320
Gbp4	Rat	dioxygen	multiple interactions	ISO	RGD:1553529	6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of GBP3 mRNA	CTD	PMID:30529165
Gbp4	Rat	dioxygen	multiple interactions	EXP		6480464	[dan-shen root extract co-treated with Andrographis paniculata extract] inhibits the reaction [[Oxygen deficiency co-treated with more ...	CTD	PMID:33729688
Gbp4	Rat	diquat	decreases expression	ISO	RGD:1553529	6480464	Diquat results in decreased expression of GBP3 mRNA; Diquat results in decreased expression of GBP4 more ...	CTD	PMID:36851058
Gbp4	Rat	disulfiram	multiple interactions	ISO	RGD:1321567	6480464	[Disulfiram binds to Copper] which results in increased expression of GBP4 mRNA	CTD	PMID:24690739
Gbp4	Rat	doxorubicin	decreases expression	ISO	RGD:1321567	6480464	Doxorubicin results in decreased expression of GBP4 mRNA	CTD	PMID:29803840
Gbp4	Rat	endosulfan	decreases expression	EXP		6480464	Endosulfan results in decreased expression of GBP4 mRNA	CTD	PMID:29391264
Gbp4	Rat	ethylparaben	increases expression	ISO	RGD:1321567	6480464	ethyl-p-hydroxybenzoate results in increased expression of GBP4 mRNA	CTD	PMID:37690743
Gbp4	Rat	Evodiamine	multiple interactions	ISO	RGD:1553529	6480464	evodiamine inhibits the reaction [Dextran Sulfate results in decreased expression of GBP4 protein]	CTD	PMID:35362542
Gbp4	Rat	fructose	multiple interactions	ISO	RGD:1553529	6480464	[lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ...	CTD	PMID:37567420
Gbp4	Rat	fulvestrant	multiple interactions	ISO	RGD:1321567	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of GBP4 gene	CTD	PMID:31601247
Gbp4	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of GBP4 mRNA	CTD	PMID:22061828\|PMID:33387578
Gbp4	Rat	glucose	multiple interactions	ISO	RGD:1553529	6480464	[lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ...	CTD	PMID:37567420
Gbp4	Rat	glyphosate	multiple interactions	ISO	RGD:1553529	6480464	[lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ...	CTD	PMID:37567420
Gbp4	Rat	inulin	multiple interactions	ISO	RGD:1553529	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of GBP3 mRNA	CTD	PMID:36331819
Gbp4	Rat	lipopolysaccharide	increases expression	ISO	RGD:1553529	6480464	Lipopolysaccharides results in increased expression of GBP3 mRNA	CTD	PMID:21461237\|PMID:27339419
Gbp4	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1321567	6480464	S-(1,2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of GBP4 mRNA]	CTD	PMID:35811015
Gbp4	Rat	lipopolysaccharide	increases expression	ISO	RGD:1321567	6480464	Lipopolysaccharides results in increased expression of GBP4 mRNA	CTD	PMID:35811015
Gbp4	Rat	methyl methanesulfonate	decreases expression	ISO	RGD:1321567	6480464	Methyl Methanesulfonate results in decreased expression of GBP4 mRNA	CTD	PMID:23649840
Gbp4	Rat	methylarsonic acid	multiple interactions	ISO	RGD:1553529	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ...	CTD	PMID:34876320
Gbp4	Rat	N-nitrosodimethylamine	increases expression	EXP		6480464	Dimethylnitrosamine results in increased expression of GBP4 mRNA	CTD	PMID:25380136
Gbp4	Rat	N-Nitrosopyrrolidine	increases expression	ISO	RGD:1321567	6480464	N-Nitrosopyrrolidine results in increased expression of GBP4 mRNA	CTD	PMID:32234424
Gbp4	Rat	nickel atom	increases expression	ISO	RGD:1321567	6480464	Nickel results in increased expression of GBP4 mRNA	CTD	PMID:24768652\|PMID:25583101
Gbp4	Rat	nickel atom	decreases expression	ISO	RGD:1321567	6480464	Nickel results in decreased expression of GBP4 mRNA	CTD	PMID:23195993
Gbp4	Rat	nickel sulfate	increases expression	ISO	RGD:1321567	6480464	nickel sulfate results in increased expression of GBP4 mRNA	CTD	PMID:22714537
Gbp4	Rat	nitrates	multiple interactions	ISO	RGD:1553529	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of GBP3 more ...	CTD	PMID:35964746
Gbp4	Rat	oxaliplatin	multiple interactions	EXP		6480464	[Oxaliplatin co-treated with Topotecan] results in increased expression of GBP4 mRNA	CTD	PMID:25729387
Gbp4	Rat	ozone	decreases expression	ISO	RGD:1553529	6480464	Ozone results in decreased expression of GBP4 mRNA	CTD	PMID:17095637\|PMID:33026818
Gbp4	Rat	ozone	multiple interactions	ISO	RGD:1553529	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ...	CTD	PMID:27106289\|PMID:34911549
Gbp4	Rat	paracetamol	increases expression	ISO	RGD:1321567	6480464	Acetaminophen results in increased expression of GBP4 mRNA	CTD	PMID:26690555
Gbp4	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of GBP4 mRNA	CTD	PMID:33387578
Gbp4	Rat	paracetamol	decreases expression	ISO	RGD:1321567	6480464	Acetaminophen results in decreased expression of GBP4 mRNA	CTD	PMID:21420995\|PMID:29067470
Gbp4	Rat	paraquat	decreases expression	EXP		6480464	Paraquat results in decreased expression of GBP4 mRNA	CTD	PMID:32680482
Gbp4	Rat	PCB138	multiple interactions	ISO	RGD:1553529	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Gbp4	Rat	pentachlorophenol	increases expression	ISO	RGD:1553529	6480464	Pentachlorophenol results in increased expression of GBP3 mRNA	CTD	PMID:23892564
Gbp4	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:1553529	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of GBP3 mRNA; [perfluorooctane sulfonic more ...	CTD	PMID:36331819
Gbp4	Rat	perfluorooctanoic acid	decreases expression	ISO	RGD:1321567	6480464	perfluorooctanoic acid results in decreased expression of GBP4 mRNA	CTD	PMID:37738295
Gbp4	Rat	phenobarbital	affects expression	ISO	RGD:1553529	6480464	Phenobarbital affects the expression of GBP3 mRNA	CTD	PMID:23091169
Gbp4	Rat	pirinixic acid	multiple interactions	ISO	RGD:1553529	6480464	[pirinixic acid co-treated with PPARA] results in decreased expression of GBP4 mRNA	CTD	PMID:20813756
Gbp4	Rat	pirinixic acid	decreases expression	ISO	RGD:1553529	6480464	pirinixic acid results in decreased expression of GBP3 mRNA; pirinixic acid results in decreased expression more ...	CTD	PMID:18445702\|PMID:20813756\|PMID:23811191
Gbp4	Rat	potassium chromate	multiple interactions	ISO	RGD:1321567	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of GBP4 mRNA	CTD	PMID:22079256
Gbp4	Rat	potassium chromate	decreases expression	ISO	RGD:1321567	6480464	potassium chromate(VI) results in decreased expression of GBP4 mRNA	CTD	PMID:22079256
Gbp4	Rat	progesterone	decreases expression	ISO	RGD:1321567	6480464	Progesterone results in decreased expression of GBP4 mRNA	CTD	PMID:20864642
Gbp4	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	RGD:1321567	6480464	S-(1,2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of GBP4 mRNA]	CTD	PMID:35811015
Gbp4	Rat	silicon dioxide	increases expression	ISO	RGD:1553529	6480464	Silicon Dioxide results in increased expression of GBP3 mRNA	CTD	PMID:23221170
Gbp4	Rat	silver atom	affects expression	ISO	RGD:1553529	6480464	Silver affects the expression of GBP3 mRNA	CTD	PMID:27131904
Gbp4	Rat	silver(0)	affects expression	ISO	RGD:1553529	6480464	Silver affects the expression of GBP3 mRNA	CTD	PMID:27131904
Gbp4	Rat	sodium arsenate	multiple interactions	ISO	RGD:1553529	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ...	CTD	PMID:34876320
Gbp4	Rat	sodium arsenite	increases expression	ISO	RGD:1553529	6480464	sodium arsenite results in increased expression of GBP3 mRNA; sodium arsenite results in increased expression more ...	CTD	PMID:17350061\|PMID:37682722
Gbp4	Rat	sodium arsenite	multiple interactions	ISO	RGD:1553529	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ...	CTD	PMID:34876320
Gbp4	Rat	sodium arsenite	decreases expression	ISO	RGD:1321567	6480464	sodium arsenite results in decreased expression of GBP4 mRNA	CTD	PMID:34032870
Gbp4	Rat	sodium arsenite	increases expression	ISO	RGD:1321567	6480464	sodium arsenite results in increased expression of GBP4 mRNA	CTD	PMID:22714537
Gbp4	Rat	sodium arsenite	affects methylation	ISO	RGD:1321567	6480464	sodium arsenite affects the methylation of GBP4 gene	CTD	PMID:28589171
Gbp4	Rat	tamoxifen	affects expression	ISO	RGD:1553529	6480464	Tamoxifen affects the expression of GBP4 mRNA	CTD	PMID:20937368
Gbp4	Rat	tert-butyl hydroperoxide	increases expression	ISO	RGD:1553529	6480464	tert-Butylhydroperoxide results in increased expression of GBP3 mRNA	CTD	PMID:14729362\|PMID:15003993
Gbp4	Rat	testosterone	decreases expression	ISO	RGD:1553529	6480464	Testosterone results in decreased expression of GBP4 mRNA	CTD	PMID:19693291
Gbp4	Rat	testosterone	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of GBP4 mRNA	CTD	PMID:32741896
Gbp4	Rat	tetrachloromethane	increases expression	ISO	RGD:1553529	6480464	Carbon Tetrachloride results in increased expression of GBP3 mRNA	CTD	PMID:27339419
Gbp4	Rat	tetrachloromethane	affects expression	ISO	RGD:1553529	6480464	Carbon Tetrachloride affects the expression of GBP4 mRNA	CTD	PMID:17484886
Gbp4	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of GBP4 mRNA	CTD	PMID:34492290
Gbp4	Rat	titanium dioxide	increases expression	ISO	RGD:1553529	6480464	titanium dioxide results in increased expression of GBP3 mRNA	CTD	PMID:23557971
Gbp4	Rat	titanium dioxide	decreases expression	ISO	RGD:1553529	6480464	titanium dioxide results in decreased expression of GBP4 mRNA	CTD	PMID:27760801\|PMID:29264374
Gbp4	Rat	topotecan	multiple interactions	EXP		6480464	[Oxaliplatin co-treated with Topotecan] results in increased expression of GBP4 mRNA	CTD	PMID:25729387
Gbp4	Rat	tremolite asbestos	decreases expression	ISO	RGD:1553529	6480464	tremolite results in decreased expression of GBP4 mRNA	CTD	PMID:29279043
Gbp4	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of GBP4 mRNA	CTD	PMID:33387578
Gbp4	Rat	triphenyl phosphate	affects expression	ISO	RGD:1321567	6480464	triphenyl phosphate affects the expression of GBP4 mRNA	CTD	PMID:37042841
Gbp4	Rat	tungsten	decreases expression	ISO	RGD:1553529	6480464	Tungsten results in decreased expression of GBP4 mRNA	CTD	PMID:30912803
Gbp4	Rat	valproic acid	decreases methylation	ISO	RGD:1321567	6480464	Valproic Acid results in decreased methylation of GBP4 gene	CTD	PMID:29154799
Gbp4	Rat	zidovudine	multiple interactions	ISO	RGD:1321567	6480464	[Zidovudine co-treated with IFNA1 protein] results in increased expression of GBP4 mRNA	CTD	PMID:20370541
Gbp4	Rat	zoledronic acid	increases expression	ISO	RGD:1321567	6480464	Zoledronic Acid results in increased expression of GBP4 mRNA	CTD	PMID:24714768

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gbp4	Rat	activation of innate immune response	involved_in	ISO	RGD:1553529	1624291	PMID:24739961	RGD	PMID:24739961
Gbp4	Rat	activation of innate immune response	involved_in	IEA	UniProtKB:Q61107\|ensembl:ENSMUSP00000101828	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gbp4	Rat	adhesion of symbiont to host	acts_upstream_of_or_within	ISO	RGD:1553529	1624291	PMID:18025219	RGD	PMID:18025219
Gbp4	Rat	adhesion of symbiont to host	acts_upstream_of_or_within	IEA	UniProtKB:Q61107\|ensembl:ENSMUSP00000101828	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gbp4	Rat	cellular response to interferon-beta	involved_in	ISO	RGD:1553529	1624291	PMID:18025219	RGD	PMID:18025219
Gbp4	Rat	cellular response to interferon-beta	acts_upstream_of_or_within	IEA	UniProtKB:Q61107\|ensembl:ENSMUSP00000101828	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gbp4	Rat	cellular response to interferon-beta	acts_upstream_of_or_within	ISO	RGD:1553529	1624291	PMID:19158679	RGD	PMID:19158679
Gbp4	Rat	cellular response to lipopolysaccharide	involved_in	ISO	RGD:1553529	1624291	PMID:24715728	RGD	PMID:24715728
Gbp4	Rat	cellular response to lipopolysaccharide	involved_in	IEA	UniProtKB:Q61107\|ensembl:ENSMUSP00000101828	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gbp4	Rat	cellular response to tumor necrosis factor	involved_in	ISO	RGD:1553529	1624291	PMID:18025219	RGD	PMID:18025219
Gbp4	Rat	cellular response to tumor necrosis factor	involved_in	IEA	UniProtKB:Q61107\|ensembl:ENSMUSP00000101828	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gbp4	Rat	cellular response to type II interferon	involved_in	ISO	RGD:1321567	1624291	PMID:17266443	RGD	PMID:17266443
Gbp4	Rat	cellular response to type II interferon	acts_upstream_of_or_within	IEA	UniProtKB:Q61107\|ensembl:ENSMUSP00000101828	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gbp4	Rat	cellular response to type II interferon	acts_upstream_of_or_within	ISO	RGD:1553529	1624291	PMID:18025219	RGD	PMID:18025219
Gbp4	Rat	cellular response to type II interferon	involved_in	IBA	MGI:1923324\|MGI:1926263\|MGI:2140937\|MGI:2444421\|MGI:3605620\|MGI:4359647\|MGI:97072\|PANTHER:PTN002473404\|UniProtKB:Q96PP9	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gbp4	Rat	cellular response to type II interferon	involved_in	IEA	ARBA:ARBA00033577	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Gbp4	Rat	cytolysis in another organism	involved_in	ISO	RGD:1553529	1624291	PMID:24715728, PMID:24739961	RGD	PMID:24715728\|PMID:24739961
Gbp4	Rat	cytolysis in another organism	involved_in	IEA	UniProtKB:Q61107\|ensembl:ENSMUSP00000101828	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gbp4	Rat	defense response to bacterium	involved_in	ISO	RGD:1553529	1624291	PMID:24715728, PMID:24739961	RGD	PMID:24715728\|PMID:24739961
Gbp4	Rat	defense response to bacterium	involved_in	IEA	UniProtKB:Q61107\|ensembl:ENSMUSP00000101828	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gbp4	Rat	defense response to Gram-positive bacterium	acts_upstream_of_or_within	IEA	UniProtKB:Q61107\|ensembl:ENSMUSP00000101828	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gbp4	Rat	defense response to Gram-positive bacterium	acts_upstream_of_or_within	ISO	RGD:1553529	1624291	PMID:18025219	RGD	PMID:18025219
Gbp4	Rat	defense response to Gram-positive bacterium	involved_in	IBA	MGI:1926263\|MGI:2140937\|MGI:2444421\|MGI:3605620\|MGI:4359647\|PANTHER:PTN002473404	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gbp4	Rat	defense response to protozoan	involved_in	IBA	MGI:1926263\|MGI:2140937\|MGI:2444421\|MGI:3605620\|MGI:4359647\|PANTHER:PTN002473404	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gbp4	Rat	defense response to protozoan	acts_upstream_of_or_within	IEA	UniProtKB:Q61107\|ensembl:ENSMUSP00000101828	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gbp4	Rat	defense response to protozoan	acts_upstream_of_or_within	ISO	RGD:1553529	1624291	PMID:18025219	RGD	PMID:18025219
Gbp4	Rat	immune system process	involved_in	IEA	UniProtKB-KW:KW-0391	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gbp4	Rat	innate immune response	involved_in	IEA	UniProtKB-KW:KW-0399	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gbp4	Rat	positive regulation of pyroptotic inflammatory response	involved_in	ISO	RGD:1553529	1624291	PMID:24715728	RGD	PMID:24715728
Gbp4	Rat	positive regulation of pyroptotic inflammatory response	involved_in	IEA	UniProtKB:Q61107\|ensembl:ENSMUSP00000101828	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gbp4	Rat	cytoplasmic vesicle	located_in	IEA	UniProtKB:Q61107\|ensembl:ENSMUSP00000101828	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gbp4	Rat	cytoplasmic vesicle	located_in	ISO	RGD:1553529	1624291	PMID:18025219	RGD	PMID:18025219
Gbp4	Rat	cytoplasmic vesicle	is_active_in	IBA	MGI:1926263\|MGI:2140937\|MGI:2444421\|MGI:3605620\|MGI:4359647\|PANTHER:PTN002473404	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gbp4	Rat	cytosol	located_in	ISO	RGD:1321567	1624291	PMID:21151871	RGD	PMID:21151871
Gbp4	Rat	cytosol	located_in	IEA	UniProtKB:Q61107\|ensembl:ENSMUSP00000101828	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gbp4	Rat	cytosol	located_in	ISO	RGD:1553529	1624291	PMID:9659399	RGD	PMID:9659399
Gbp4	Rat	Golgi apparatus	located_in	ISO	RGD:1321567	1624291		RGD	GO_REF:0000052
Gbp4	Rat	nucleus	located_in	ISO	RGD:1321567	1624291	PMID:17266443, PMID:21151871	RGD	PMID:17266443\|PMID:21151871
Gbp4	Rat	perinuclear region of cytoplasm	located_in	ISO	RGD:1321567	1624291	PMID:17266443	RGD	PMID:17266443
Gbp4	Rat	plasma membrane	located_in	ISO	RGD:1321567	1624291		RGD	GO_REF:0000052

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gbp4	Rat	GTP binding	enables	IBA	FB:FBgn0039213\|MGI:106611\|MGI:2444421\|PANTHER:PTN000079086\|RGD:1359232\|UniProtKB:P32455	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gbp4	Rat	GTP binding	enables	IEA	InterPro:IPR003191\|InterPro:IPR015894\|InterPro:IPR030386\|InterPro:IPR036543	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gbp4	Rat	GTP binding	enables	IEA	UniProtKB-KW:KW-0342	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gbp4	Rat	GTPase activity	enables	IBA	FB:FBgn0039213\|MGI:106611\|MGI:2444421\|MGI:95666\|PANTHER:PTN000079086\|RGD:1359232\|TAIR:locus:2024203\|TAIR:locus:2161358\|UniProtKB:P32455\|UniProtKB:Q8WXF7\|UniProtKB:Q96PP8	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gbp4	Rat	GTPase activity	enables	IEA	InterPro:IPR003191\|InterPro:IPR015894\|InterPro:IPR036543\|InterPro:IPR037684	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gbp4	Rat	identical protein binding	enables	ISO	RGD:1321567	1624291	UniProtKB:Q96PP9 PMID:21151871	RGD	PMID:21151871
Gbp4	Rat	protein binding	enables	ISO	RGD:1321567	1624291	UniProtKB:P32455\|UniProtKB:P32456\|UniProtKB:Q96PP8\|UniProtKB:Q9H0R5 PMID:21151871	RGD	PMID:21151871
Gbp4	Rat	protein homodimerization activity	enables	ISO	RGD:1321567	1624291	PMID:21151871	RGD	PMID:21151871

Disease Annotations Click to see Annotation Detail View

Experimental Liver Cirrhosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

(-)-epigallocatechin 3-gallate (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dichloroethane (ISO)

1,3-dinitrobenzene (EXP)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

2,4,6-trinitrobenzenesulfonic acid (ISO)

4,4'-diaminodiphenylmethane (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

aluminium atom (ISO)

aluminium(0) (ISO)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

benzoates (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (EXP)

cantharidin (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloroprene (ISO)

chlorpyrifos (ISO)

cholesterol (ISO)

copper atom (ISO)

copper(0) (ISO)

corosolic acid (ISO)

cyclophosphamide (ISO)

cytarabine (ISO)

D-glucose (ISO)

dextran sulfate (ISO)

dibenz[a,h]anthracene (ISO)

diclofenac (ISO)

diiodine (ISO)

dimethylarsinic acid (ISO)

dioxygen (EXP,ISO)

diquat (ISO)

disulfiram (ISO)

doxorubicin (ISO)

endosulfan (EXP)

ethylparaben (ISO)

Evodiamine (ISO)

fructose (ISO)

fulvestrant (ISO)

gentamycin (EXP)

glucose (ISO)

glyphosate (ISO)

inulin (ISO)

lipopolysaccharide (ISO)

methyl methanesulfonate (ISO)

methylarsonic acid (ISO)

N-nitrosodimethylamine (EXP)

N-Nitrosopyrrolidine (ISO)

nickel atom (ISO)

nickel sulfate (ISO)

nitrates (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

PCB138 (ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

progesterone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

tamoxifen (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (EXP,ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

tremolite asbestos (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

tungsten (ISO)

valproic acid (ISO)

zidovudine (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

activation of innate immune response (IEA,ISO)

adhesion of symbiont to host (IEA,ISO)

cellular response to interferon-beta (IEA,ISO)

cellular response to lipopolysaccharide (IEA,ISO)

cellular response to tumor necrosis factor (IEA,ISO)

cellular response to type II interferon (IBA,IEA,ISO)

cytolysis in another organism (IEA,ISO)

defense response to bacterium (IEA,ISO)

defense response to Gram-positive bacterium (IBA,IEA,ISO)

defense response to protozoan (IBA,IEA,ISO)

immune system process (IEA)

innate immune response (IEA)

positive regulation of pyroptotic inflammatory response (IEA,ISO)

Cellular Component

cytoplasmic vesicle (IBA,IEA,ISO)

cytosol (IEA,ISO)

Golgi apparatus (ISO)

nucleus (ISO)

perinuclear region of cytoplasm (ISO)

plasma membrane (ISO)

Molecular Function

GTP binding (IBA,IEA)

GTPase activity (IBA,IEA)

identical protein binding (ISO)

protein binding (ISO)

protein homodimerization activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:18025219	PMID:21551061

Genomics

Comparative Map Data

Gbp4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	233,978,163 - 233,992,124 (+)	NCBI		GRCr8
mRatBN7.2	2	231,304,910 - 231,318,883 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	231,305,244 - 231,318,879 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	239,078,909 - 239,092,524 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	236,973,203 - 236,986,820 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	231,836,590 - 231,850,207 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	248,249,232 - 248,263,104 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	248,249,468 - 248,263,168 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	266,777,820 - 266,791,543 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	240,495,963 - 240,509,393 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	240,453,144 - 240,495,609 (+)	NCBI
Celera	2	223,352,892 - 223,366,524 (+)	NCBI		Celera
Cytogenetic Map	2	q44	NCBI

GBP4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	89,181,144 - 89,198,942 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	89,181,144 - 89,198,942 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	89,646,827 - 89,664,625 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	89,420,044 - 89,437,150 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	89,359,480 - 89,376,583	NCBI
Celera	1	87,892,646 - 87,910,446 (-)	NCBI		Celera
Cytogenetic Map	1	p22.2	NCBI
HuRef	1	87,764,057 - 87,781,858 (-)	NCBI		HuRef
CHM1_1	1	89,761,894 - 89,779,694 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	89,024,523 - 89,042,320 (-)	NCBI		T2T-CHM13v2.0

Gbp3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	142,265,781 - 142,278,974 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	142,265,787 - 142,278,970 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	142,560,016 - 142,573,213 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	142,560,026 - 142,573,209 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	142,223,016 - 142,236,176 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	142,497,531 - 142,510,595 (+)	NCBI		MGSCv36	mm8
Celera	3	148,982,608 - 148,995,787 (+)	NCBI		Celera
Cytogenetic Map	3	H1	NCBI
cM Map	3	66.69	NCBI

GBP7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	137,799,420 - 137,843,619 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	136,955,167 - 136,999,366 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	91,841,867 - 91,886,638 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	90,593,577 - 90,637,789 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	90,590,242 - 90,660,565 (-)	Ensembl	panpan1.1		panPan2

Variants

Variants in Gbp4
46 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	113
Count of miRNA genes:	90
Interacting mature miRNAs:	93
Transcripts:	ENSRNOT00000022648
Prediction methods:	Microtar, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631563	Hcuc3	Hepatic copper content QTL 3	3.87		liver copper amount (VT:0003065)	liver copper weight to liver dry weight ratio (CMO:0001512)	2	229059610	249053267	Rat
1331767	Hrtrt12	Heart rate QTL 12	3.373		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	218414747	240841241	Rat
1598813	Memor9	Memory QTL 9	2.7		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	199341726	234244620	Rat
8693697	Alc36	Alcohol consumption QTL 36	2	0.592	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	2	217139753	236660713	Rat
1298075	Scl17	Serum cholesterol level QTL 17	3.4		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	211744537	249053267	Rat
2293833	Kiddil8	Kidney dilation QTL 8	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	219753301	247136170	Rat
1598835	Anxrr18	Anxiety related response QTL 18	2.98		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	2	200990457	245990457	Rat
2298479	Eau5	Experimental allergic uveoretinitis QTL 5		0.0021	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	2	202446871	237938339	Rat
1300126	Bp175	Blood pressure QTL 175	3.46		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	214226044	247136170	Rat
7207490	Bss111	Bone structure and strength QTL 111	6.4		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	2	211744537	249053267	Rat
7207484	Bss108	Bone structure and strength QTL 108	5.3		femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	2	211744537	249053267	Rat
2313073	Bmd75	Bone mineral density QTL 75	4.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	2	215377404	237938339	Rat
8693622	Alc26	Alcohol consumption QTL 26	2.4	0.667	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	2	221136523	241305619	Rat
7411555	Bw132	Body weight QTL 132		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	2	223389739	249053267	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	189599258	234599258	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189599258	234599258	Rat
9587428	Epfw6	Epididymal fat weight QTL 6	7.47	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	2	223389739	249053267	Rat
7207482	Bss107	Bone structure and strength QTL 107	7		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	2	211744537	249053267	Rat
2293844	Kiddil7	Kidney dilation QTL 7	3.5		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	219753301	247136170	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	193452645	245889826	Rat
1549836	Bss2	Bone structure and strength QTL 2	7.5		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	2	211744537	249053267	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
2317885	Alcrsp28	Alcohol response QTL 28	2.1	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	212828222	249053267	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001305261	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006233424	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225190	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000022648 ⟹ ENSRNOP00000022648

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	231,305,244 - 231,318,879 (+)	Ensembl
Rnor_6.0 Ensembl	2	248,249,468 - 248,263,168 (+)	Ensembl

RefSeq Acc Id:

NM_001305261 ⟹ NP_001292190

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	233,978,486 - 233,992,120 (+)	NCBI
mRatBN7.2	2	231,305,244 - 231,318,879 (+)	NCBI
Rnor_6.0	2	248,249,470 - 248,263,104 (+)	NCBI
Celera	2	223,352,892 - 223,366,524 (+)	NCBI

Sequence:

show sequence

GGTTCCCTTTATCTCAATTTGTATGTGGGTGGCTGTTACTTTGACACTTCTAACAGTGGCTGCT
TCAAGGGAGCCTGGAGCAGTAGGAAGCTCAGTGAATGAACCAAGTTGGCTGAGGACTGTCAGGG
TTTTGGAGCCAGAGCGCCTGGGGAGCTGTGGTGTCTGAGTCTACCATGGAGGCACCCATTTGTC
TGGTGCAAAACTGGAAAGAGCAGCTGACAGTAAATCTGGAGGCCATAGGGATTCTTGAGCAGAT
AGCACAGCCTCTGGTGGTGGTGGCCATTGTTGGTTTATATCGGACAGGGAAGTCCTACCTCATG
AATCGCCTTGCAGGACGGAACCACGGCTTCTCCTTGGGCTCCACAGTGCAATCAGAGACCAAGG
GCATCTGGATGTGGTGTGTGCCCCATCCCACCAAGCCAACCCACACCCTGGTCCTTCTGGACAC
TGAGGGTCTTGGCGATGTAGAAAAGGGTGACCCTAAGAATGACTCATGGATCTTCGCCTTGGCC
GTGCTTCTGAGCAGCACCTTTGTCTACAACAGCATGAGCACCATCAACCACCAGGCCCTGGAGC
AGCTGCACTATGTGACTGAATTAACACAACTAATCCGAGCAAAATCAGACCCCAGGGAGGATAA
AGTGGAGGACTCTAGTGAGTTTGTAGGTTTCTTCCCAGACTTCATCTGGGCTGTTCGAGATTTT
GTTCTGGAGTTGAAGTTAGATGGTCGGCCCATCACAGAAGATGAGTACCTGGAGAATGCCCTGA
AGCTGATCCCAGAAAACAATCCCAAAGGCCAAAAGTCCAACATGACCAGAGAATGTATCAGATA
TTTTTTCCCGGTACGGAAGTGCTTTGTCTTTGATAGGCCCACAAACGACAAAAGTTTATTATTC
CAAATTGAAAACGTTCCAGAAAACCAACTAGAGTGGAATTTCCAAGTTGAATCAGAAAATTTCT
GTTCCTATATCTTTGCCAATGGCAAGACCAAGACGCTGAGAGGGGGAGTCATTGTCACAGGAAA
TCGGCTGGGGACTTTGGTGCAGACCTATGTGGATGCCATCAACAGTGGAACTGTGCCATGTTTG
GAGAACGCAGTGACGGCCCTGGCCCAACGTGAGAACTCTGCAGCTGTGCAGAAGGCAGCTGAGC
ACTACGCTGAGCAGATGGCCCAGAGACTAAGGCTCCCCACAGACACTCTCCAGGAGCTGCTGGA
GGTGCACTCAGCCTGTGAGAAGGAAGCCATTGCTGTCTTCATGGAGCACTCCTTCAAGGATGAT
GAACAGGAGTTTCAGAAGAGGCTGGTGGCCACCATAGAGAAATGGAAGGAAGAGTTCATGCTAC
GGAATGAAGCAGCATCCATCCGGCACTGCCAGGCTGAGCTGGAGAAGCTTTCAGAGTCCCTGAA
GGAAAGCATCTCATGTGGAGCTTTCTCTGTTCCGGGGGGGCACAGCCTCTACTTAGAAGCCAGG
AAGAAGGTTGAGCTGAGCTACGAGCAAGTGCCGAGGAAGGGAGTGAAGGCAAAAGAAGTCCTTA
AGAGTTTCCTACAGTCACAGGCTACTGTGGAGAACTCCATCCTGCAGTCAGACAAAGCTCTTAC
AGATGGAGAGAGGGCCGTAGCAGCTGAGCGGACCAAGAAGGAGGTGGCTGAGAAGGAAAGAGAG
CTGCTGAAACAGAGACAGAAGGAGCAAGAGCAAGTGATGGAGGCTCAGGAGAGAAGTTTCCAAG
AAAACATTGCTAAGCTTCAGGAGAAGATGGAGAGGGAAAGGGTGATGCTGCTCAGGGAGCAGGA
GAAGATGATGGAGCACAAGCTGAAGGTCCAAAAAGAACTGCTTGTTGAAGGATTCAGAAAGAAA
TCTGATATGTTAAAGAATGAAATAAGTCAACTGAGAGAAGAGATCGAAAGAACAAGAAAGAAAC
CCTCACTGTTTGCACACATCCTTGACACAGTTGGCAATGCATTCATTATGATTTTACCAGGAGC
TGGTAAAATATGTGGTGCGGGGATGAAAGTCCTTAGCTCACTTATGAAGTAGTCTGAAGAGTTT
CTGGGACGGAATATATAAAAACCAAGCTTCTATCATTTTGATACCAACTGTGTTTTTTAATACA
TGTGCTTTGGATTTTAAATACATGTGCTACTTTAGTAACTCATATTACAACGAAGTCAGAACTC
TCGTTAATAGCTAGATAATCAGATACAGCTTCATTGGAGTTGAGTTCTGTGTCCGTTCATTGCC
AGTTATATTCAAGGTTAAAGATACAAACCAATGAAGAATATAAGGATCATGCATACATAAATAC
CACCAAATTTCATTGCCACAATCTCTGTAATAAAGAGGGAAACCAGTCAGAATATAGTGAAATT
GTTAATAGAAAAGGTGTAAAATAAATCAAACAGAAATATGGCCACATGGAGACACATTGGCAAT
TGTATCCCAGTCTTACAGGACAGATAATTTGTTACAAAGATCTCTTGTAAAAACTGACAAGTGG
GTTTTCATAGGACCGGAAGTATGAGAAAAATGATTGATAATAAAAGCAGTGCATATTAAATTTA

hide sequence

RefSeq Acc Id:

XM_006233424 ⟹ XP_006233486

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	233,978,163 - 233,992,124 (+)	NCBI
mRatBN7.2	2	231,304,910 - 231,318,883 (+)	NCBI
Rnor_6.0	2	248,249,232 - 248,263,104 (+)	NCBI
Rnor_5.0	2	266,777,820 - 266,791,543 (+)	NCBI

Sequence:

show sequence

AGACTTGTATGCCAAGTGTGGTTCTGTTTTCTCTGTTTTTAATATCAGTGATGGAACACGCTCT
GGAAAAGAAAACACTCTCAAACTGCGAAATGTGGCAGGGTGATAACTTCAAAAGTCCAGATGAA
TCTTGGAAATTCCTCCTGCTCAACTCAGCTCAGCTGACATCACAAACTCAGTTATTTTGTTCGA
GCCCTCAGTGACTGAGTCATCTGGCAAGAAGCAGGGTTTCGATTTCGGTTCCCTTTATCTCAAT
TTGTATGTGGGTGGCTGTTACTTTGACACTTCTAACAGTGGCTGCTTCAAGGGAGCCTGGAGCA
GTAGGAAGCTCAGTGAATGAACCAAGTTGGCTGAGGACTGTCAGGGTTTTGGAGCCAGAGCGCC
TGGGGAGCTGTGGTGTCTGAGTCTACCATGGAGGCACCCATTTGTCTGGTGCAAAACTGGAAAG
AGCAGCTGACAGTAAATCTGGAGGCCATAGGGATTCTTGAGCAGATAGCACAGCCTCTGGTGGT
GGTGGCCATTGTTGGTTTATATCGGACAGGGAAGTCCTACCTCATGAATCGCCTTGCAGGACGG
AACCACGGCTTCTCCTTGGGCTCCACAGTGCAATCAGAGACCAAGGGCATCTGGATGTGGTGTG
TGCCCCATCCCACCAAGCCAACCCACACCCTGGTCCTTCTGGACACTGAGGGTCTTGGCGATGT
AGAAAAGGGTGACCCTAAGAATGACTCATGGATCTTCGCCTTGGCCGTGCTTCTGAGCAGCACC
TTTGTCTACAACAGCATGAGCACCATCAACCACCAGGCCCTGGAGCAGCTGCACTATGTGACTG
AATTAACACAACTAATCCGAGCAAAATCAGACCCCAGGGAGGATAAAGTGGAGGACTCTAGTGA
GTTTGTAGGTTTCTTCCCAGACTTCATCTGGGCTGTTCGAGATTTTGTTCTGGAGTTGAAGTTA
GATGGTCGGCCCATCACAGAAGATGAGTACCTGGAGAATGCCCTGAAGCTGATCCCAGAAAACA
ATCCCAAAGGCCAAAAGTCCAACATGACCAGAGAATGTATCAGATATTTTTTCCCGGTACGGAA
GTGCTTTGTCTTTGATAGGCCCACAAACGACAAAAGTTTATTATTCCAAATTGAAAACGTTCCA
GAAAACCAACTAGAGTGGAATTTCCAAGTTGAATCAGAAAATTTCTGTTCCTATATCTTTGCCA
ATGGGCTGGGGACTTTGGTGCAGACCTATGTGGATGCCATCAACAGTGGAACTGTGCCATGTTT
GGAGAACGCAGTGACGGCCCTGGCCCAACGTGAGAACTCTGCAGCTGTGCAGAAGGCAGCTGAG
CACTACGCTGAGCAGATGGCCCAGAGACTAAGGCTCCCCACAGACACTCTCCAGGAGCTGCTGG
AGGTGCACTCAGCCTGTGAGAAGGAAGCCATTGCTGTCTTCATGGAGCACTCCTTCAAGGATGA
TGAACAGGAGTTTCAGAAGAGGCTGGTGGCCACCATAGAGAAATGGAAGGAAGAGTTCATGCTA
CGGAATGAAGCAGCATCCATCCGGCACTGCCAGGCTGAGCTGGAGAAGCTTTCAGAGTCCCTGA
AGGAAAGCATCTCATGTGGAGCTTTCTCTGTTCCGGGGGGGCACAGCCTCTACTTAGAAGCCAG
GAAGAAGGTTGAGCTGAGCTACGAGCAAGTGCCGAGGAAGGGAGTGAAGGCAAAAGAAGTCCTT
AAGAGTTTCCTACAGTCACAGGCTACTGTGGAGAACTCCATCCTGCAGTCAGACAAAGCTCTTA
CAGATGGAGAGAGGGCCGTAGCAGCTGAGCGGACCAAGAAGGAGGTGGCTGAGAAGGAAAGAGA
GCTGCTGAAACAGAGACAGAAGGAGCAAGAGCAAGTGATGGAGGCTCAGGAGAGAAGTTTCCAA
GAAAACATTGCTAAGCTTCAGGAGAAGATGGAGAGGGAAAGGGTGATGCTGCTCAGGGAGCAGG
AGAAGATGATGGAGCACAAGCTGAAGGTCCAAAAAGAACTGCTTGTTGAAGGATTCAGAAAGAA
ATCTGATATGTTAAAGAATGAAATAAGTCAACTGAGAGAAGAGATCGAAAGAACAAGAAAGAAA
CCCTCACTGTTTGCACACATCCTTGACACAGTTGGCAATGCATTCATTATGATTTTACCAGGAG
CTGGTAAAATATGTGGTGCGGGGATGAAAGTCCTTAGCTCACTTATGAAGTAGTCTGAAGAGTT
TCTGGGACGGAATATATAAAAACCAAGCTTCTATCATTTTGATACCAACTGTGTTTTTTAATAC
ATGTGCTTTGGATTTTAAATACATGTGCTACTTTAGTAACTCATATTACAACGAAGTCAGAACT
CTCGTTAATAGCTAGATAATCAGATACAGCTTCATTGGAGTTGAGTTCTGTGTCCGTTCATTGC
CAGTTATATTCAAGGTTAAAGATACAAACCAATGAAGAATATAAGGATCATGCATACATAAATA
CCACCAAATTTCATTGCCACAATCTCTGTAATAAAGAGGGAAACCAGTCAGAATATAGTGAAAT
TGTTAATAGAAAAGGTGTAAAATAAATCAAACAGAAATATGGCCACATGGAGACACATTGGCAA
TTGTATCCCAGTCTTACAGGACAGATAATTTGTTACAAAGATCTCTTGTAAAAACTGACAAGTG
GGTTTTCATAGGACCGGAAGTATGAGAAAAATGATTGATAATAAAAGCAGTGCATATTAAATTT
A

hide sequence

Protein Sequences


Protein RefSeqs	NP_001292190	(Get FASTA)	NCBI Sequence Viewer
	XP_006233486	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL82351	(Get FASTA)	NCBI Sequence Viewer
	EDL82352	(Get FASTA)	NCBI Sequence Viewer
	EDL82353	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000022648
	ENSRNOP00000022648.3

RefSeq Acc Id:	XP_006233486 ⟸ XM_006233424
- Peptide Label:	isoform X1
- UniProtKB:	A6HW65 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEAPICLVQNWKEQLTVNLEAIGILEQIAQPLVVVAIVGLYRTGKSYLMNRLAGRNHGFSLGST VQSETKGIWMWCVPHPTKPTHTLVLLDTEGLGDVEKGDPKNDSWIFALAVLLSSTFVYNSMSTI NHQALEQLHYVTELTQLIRAKSDPREDKVEDSSEFVGFFPDFIWAVRDFVLELKLDGRPITEDE YLENALKLIPENNPKGQKSNMTRECIRYFFPVRKCFVFDRPTNDKSLLFQIENVPENQLEWNFQ VESENFCSYIFANGLGTLVQTYVDAINSGTVPCLENAVTALAQRENSAAVQKAAEHYAEQMAQR LRLPTDTLQELLEVHSACEKEAIAVFMEHSFKDDEQEFQKRLVATIEKWKEEFMLRNEAASIRH CQAELEKLSESLKESISCGAFSVPGGHSLYLEARKKVELSYEQVPRKGVKAKEVLKSFLQSQAT VENSILQSDKALTDGERAVAAERTKKEVAEKERELLKQRQKEQEQVMEAQERSFQENIAKLQEK MERERVMLLREQEKMMEHKLKVQKELLVEGFRKKSDMLKNEISQLREEIERTRKKPSLFAHILD TVGNAFIMILPGAGKICGAGMKVLSSLMK hide sequence

RefSeq Acc Id:

NP_001292190 ⟸ NM_001305261

- UniProtKB:

D3ZQL3 (UniProtKB/TrEMBL), A6HW67 (UniProtKB/TrEMBL), A6HW65 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEAPICLVQNWKEQLTVNLEAIGILEQIAQPLVVVAIVGLYRTGKSYLMNRLAGRNHGFSLGST
VQSETKGIWMWCVPHPTKPTHTLVLLDTEGLGDVEKGDPKNDSWIFALAVLLSSTFVYNSMSTI
NHQALEQLHYVTELTQLIRAKSDPREDKVEDSSEFVGFFPDFIWAVRDFVLELKLDGRPITEDE
YLENALKLIPENNPKGQKSNMTRECIRYFFPVRKCFVFDRPTNDKSLLFQIENVPENQLEWNFQ
VESENFCSYIFANGKTKTLRGGVIVTGNRLGTLVQTYVDAINSGTVPCLENAVTALAQRENSAA
VQKAAEHYAEQMAQRLRLPTDTLQELLEVHSACEKEAIAVFMEHSFKDDEQEFQKRLVATIEKW
KEEFMLRNEAASIRHCQAELEKLSESLKESISCGAFSVPGGHSLYLEARKKVELSYEQVPRKGV
KAKEVLKSFLQSQATVENSILQSDKALTDGERAVAAERTKKEVAEKERELLKQRQKEQEQVMEA
QERSFQENIAKLQEKMERERVMLLREQEKMMEHKLKVQKELLVEGFRKKSDMLKNEISQLREEI
ERTRKKPSLFAHILDTVGNAFIMILPGAGKICGAGMKVLSSLMK

hide sequence

Ensembl Acc Id:

ENSRNOP00000022648 ⟸ ENSRNOT00000022648

Protein Domains

GB1/RHD3-type G

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZQL3-F1-model_v2	AlphaFold	D3ZQL3	1-620	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310579	AgrOrtholog
BioCyc Gene	G2FUF-50997	BioCyc
Ensembl Genes	ENSRNOG00000028768	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000022648	ENTREZGENE
	ENSRNOT00000022648.6	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.300	UniProtKB/TrEMBL
	Guanylate-binding protein, C-terminal domain	UniProtKB/TrEMBL
InterPro	G_GB1_RHD3_dom	UniProtKB/TrEMBL
	GBP_C	UniProtKB/TrEMBL
	Guanylate-bd_C	UniProtKB/TrEMBL
	Guanylate-bd_C_sf	UniProtKB/TrEMBL
	Guanylate-bd_N	UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/TrEMBL
KEGG Report	rno:310917	UniProtKB/TrEMBL
NCBI Gene	310917	ENTREZGENE
PANTHER	GUANYLATE BINDING PROTEIN	UniProtKB/TrEMBL
Pfam	GBP	UniProtKB/TrEMBL
	GBP_C	UniProtKB/TrEMBL
PhenoGen	Gbp4	PhenoGen
PROSITE	G_GB1_RHD3	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000028768	RatGTEx
Superfamily-SCOP	GBP	UniProtKB/TrEMBL
	SSF52540	UniProtKB/TrEMBL
UniProt	A6HW65	ENTREZGENE, UniProtKB/TrEMBL
	A6HW67	ENTREZGENE, UniProtKB/TrEMBL
	D3ZQL3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Gbp4	guanylate binding protein 4	LOC100911495	guanylate-binding protein 4-like	Data merged from RGD:6492963	737654	PROVISIONAL
2012-07-05	LOC100911495	guanylate-binding protein 4-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-03-12	Gbp4	guanylate binding protein 4	Gbp4_predicted	guanylate nucleotide binding protein 4 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Gbp4_predicted	guanylate nucleotide binding protein 4 (predicted)	Gbp3_predicted	guanylate nucleotide binding protein 3 (predicted)	Symbol and Name updated	1299863	APPROVED
2005-01-12	Gbp3_predicted	guanylate nucleotide binding protein 3 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD