Plekhf1 (pleckstrin homology and FYVE domain containing 1)

Advanced Search (OLGA)

Gene: Plekhf1 (pleckstrin homology and FYVE domain containing 1) Rattus norvegicus

Analyze

Symbol:

Plekhf1

Name:

pleckstrin homology and FYVE domain containing 1

RGD ID:

1310544

Description:

Predicted to enable phosphatidylinositol-3-phosphate binding activity; phosphatidylinositol-4-phosphate binding activity; and phosphatidylinositol-5-phosphate binding activity. Predicted to be involved in several processes, including endosome to lysosome transport; positive regulation of intrinsic apoptotic signaling pathway; and protein localization to plasma membrane. Predicted to be located in endosome. Predicted to be active in early endosome and lysosome. Orthologous to human PLEKHF1 (pleckstrin homology and FYVE domain containing 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC308543; PH domain-containing family F member 1; pleckstrin homology domain containing, family F (with FYVE domain) member 1; pleckstrin homology domain-containing family F member 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	100,045,340 - 100,046,817 (-)	NCBI		GRCr8
mRatBN7.2	1	90,908,304 - 90,915,862 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	90,904,742 - 90,915,820 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	96,304,107 - 96,305,583 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	104,769,821 - 104,771,297 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	98,062,634 - 98,064,111 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	94,609,041 - 94,616,565 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	94,609,377 - 94,610,854 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	95,700,153 - 95,707,361 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	90,697,260 - 90,698,737 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	90,775,372 - 90,776,840 (-)	NCBI
Celera	1	85,240,535 - 85,242,012 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Ovarian Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

(S)-colchicine (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (ISO)

adenine (ISO)

afimoxifene (ISO)

aflatoxin B1 (EXP,ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

buta-1,3-diene (ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

chloroprene (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

cobalt dichloride (EXP,ISO)

Cuprizon (EXP)

cypermethrin (ISO)

DDE (ISO)

decabromodiphenyl ether (ISO)

dexamethasone (ISO)

diazinon (EXP)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dieldrin (EXP)

dimethyl sulfoxide (ISO)

diuron (EXP)

doxorubicin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

ethyl methanesulfonate (ISO)

fenthion (ISO)

ferric oxide (ISO)

fluoranthene (ISO)

flutamide (EXP)

furan (EXP)

glyphosate (ISO)

indometacin (ISO)

methamphetamine (EXP)

methyl methanesulfonate (ISO)

nickel dichloride (EXP)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

propanal (ISO)

propiconazole (ISO)

resveratrol (ISO)

SCH 23390 (EXP)

sodium arsenate (ISO)

sodium arsenite (ISO)

sulindac (ISO)

temozolomide (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (ISO)

triphenyl phosphate (ISO)

Triptolide (ISO)

troglitazone (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IEA)

endosome organization (IBA,ISO)

endosome to lysosome transport (IBA)

positive regulation of autophagy (IBA,ISO)

positive regulation of intrinsic apoptotic signaling pathway (IBA)

protein localization to plasma membrane (ISO)

vesicle organization (ISO)

Cellular Component

early endosome (IBA)

endosome (ISO)

lysosome (IBA,ISO)

nucleus (IEA)

perinuclear region of cytoplasm (IEA)

Molecular Function

metal ion binding (IEA)

phosphatidylinositol binding (IBA)

phosphatidylinositol-3-phosphate binding (ISO)

phosphatidylinositol-4-phosphate binding (ISO)

phosphatidylinositol-5-phosphate binding (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:22115783

Genomics

Comparative Map Data

Plekhf1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	100,045,340 - 100,046,817 (-)	NCBI		GRCr8
mRatBN7.2	1	90,908,304 - 90,915,862 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	90,904,742 - 90,915,820 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	96,304,107 - 96,305,583 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	104,769,821 - 104,771,297 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	98,062,634 - 98,064,111 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	94,609,041 - 94,616,565 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	94,609,377 - 94,610,854 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	95,700,153 - 95,707,361 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	90,697,260 - 90,698,737 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	90,775,372 - 90,776,840 (-)	NCBI
Celera	1	85,240,535 - 85,242,012 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

PLEKHF1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	29,665,461 - 29,675,477 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	29,665,459 - 29,675,477 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	30,156,368 - 30,166,384 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	34,848,167 - 34,858,224 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	34,847,802 - 34,858,204	NCBI
Celera	19	26,854,527 - 26,864,585 (+)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI
HuRef	19	26,668,787 - 26,678,845 (+)	NCBI		HuRef
CHM1_1	19	30,157,659 - 30,167,716 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	32,191,180 - 32,201,225 (+)	NCBI		T2T-CHM13v2.0

Plekhf1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	37,920,078 - 37,927,418 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	37,916,396 - 37,927,440 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	38,220,654 - 38,227,994 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	38,216,972 - 38,228,016 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	39,005,673 - 39,013,013 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	37,929,761 - 37,937,047 (-)	NCBI		MGSCv36	mm8
Celera	7	33,384,111 - 33,391,399 (-)	NCBI		Celera
Cytogenetic Map	7	B3	NCBI
cM Map	7	25.36	NCBI

Plekhf1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	7,934,024 - 7,943,499 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955468	7,934,024 - 7,943,499 (-)	NCBI	ChiLan1.0	ChiLan1.0

PLEKHF1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	35,646,442 - 35,656,852 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	37,643,651 - 37,653,763 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	26,593,833 - 26,604,514 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	35,354,315 - 35,364,366 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

PLEKHF1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	121,776,122 - 121,802,881 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	121,781,181 - 121,782,578 (-)	NCBI	CanFam3.1		canFam3	CanFam3.1
CanFam3.1 Ensembl	1	121,781,181 - 121,782,578 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
ROS_Cfam_1.0	1	122,402,959 - 122,431,800 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	122,409,980 - 122,411,377 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	121,982,589 - 122,011,226 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	121,595,581 - 121,618,885 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	122,654,118 - 122,682,943 (-)	NCBI		UU_Cfam_GSD_1.0

Plekhf1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	5,976,223 - 5,987,835 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936570	5,658,052 - 5,666,358 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936570	5,658,052 - 5,666,711 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PLEKHF1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	39,786,199 - 39,797,583 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	39,786,201 - 39,797,578 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	35,145,695 - 35,157,120 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PLEKHF1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	24,732,774 - 24,743,636 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	24,742,024 - 24,742,863 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	2,264,800 - 2,275,582 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Plekhf1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	4,843,635 - 4,852,346 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624794	4,843,342 - 4,852,346 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Plekhf1
28 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	61
Count of miRNA genes:	59
Interacting mature miRNAs:	60
Transcripts:	ENSRNOT00000020383
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	85424647	100358001	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	90532338	123479925	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	82174743	118944897	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889494	Scort2	Serum corticosterone level QTL 2	4.2		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	80592172	125592172	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	90508614	173018436	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	90508614	180359386	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
1300153	Bp171	Blood pressure QTL 171	3.37		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	90664883	143200202	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514)	1	83547917	128547917	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	78430754	91209302	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	87580395	150700247	Rat

Markers in Region

RH129691

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	90,908,685 - 90,908,890 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	94,609,423 - 94,609,627	NCBI	Rnor6.0
Rnor_5.0	1	95,700,222 - 95,700,426	UniSTS	Rnor5.0
RGSC_v3.4	1	90,697,308 - 90,697,512	UniSTS	RGSC3.4
Celera	1	85,240,583 - 85,240,787	UniSTS
RH 3.4 Map	1	882.2	UniSTS
Cytogenetic Map	1	q22	UniSTS

RH137172

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	90,908,725 - 90,908,919 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	94,609,463 - 94,609,656	NCBI	Rnor6.0
Rnor_5.0	1	95,700,262 - 95,700,455	UniSTS	Rnor5.0
RGSC_v3.4	1	90,697,348 - 90,697,541	UniSTS	RGSC3.4
Celera	1	85,240,623 - 85,240,816	UniSTS
RH 3.4 Map	1	884.59	UniSTS
Cytogenetic Map	1	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013148	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC120712	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079354	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225960	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000020383 ⟹ ENSRNOP00000020352

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	90,908,316 - 90,915,068 (-)	Ensembl
Rnor_6.0 Ensembl	1	94,609,377 - 94,610,854 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108120 ⟹ ENSRNOP00000081760

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	90,908,316 - 90,910,629 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113101 ⟹ ENSRNOP00000091851

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	90,904,742 - 90,915,820 (-)	Ensembl

RefSeq Acc Id:

NM_001013148 ⟹ NP_001013166

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	100,045,340 - 100,046,817 (-)	NCBI
mRatBN7.2	1	90,908,638 - 90,910,115 (-)	NCBI
Rnor_6.0	1	94,609,375 - 94,610,852 (-)	NCBI
Rnor_5.0	1	95,700,153 - 95,707,361 (-)	NCBI
RGSC_v3.4	1	90,697,260 - 90,698,737 (-)	RGD
Celera	1	85,240,535 - 85,242,012 (-)	RGD

Sequence:

show sequence

TCCTACGAGAGCTTAGCTATTGAGAAGATGGTGGACCACTTGGCAAACACAGAGATCAACAGCC
AACGGATTGCAGCGGTGGAGAACTGTTTTGGGGCATCGGGGCAACCGCTGGCCCTGCCGGGCCG
TGTGCTCCTAGGCGAGGGAGTGCTGACCAAGGAGTGCCGCAAAAAGGCCAAGCCGCGCATCTTC
TTCCTTTTCAACGACATCCTGGTGTATGGCAGCATTGTGCTGAGCAAGCGCAAGTACCGCAGCC
AGCATATCATCCCCCTGGAAGAGGTAACTCTGGAGCCACTGCCGGAGACCCTGCAGGCCAAGAA
CCGCTGGATGATCAAGACAGCCAAGAAGTCCTTCGTGGTCTCGGCAGCCTCCACCACAGAGCGC
CAGGAATGGATAAGCCACATCGAAGAGTGCGTGCGGAGGCAGCTGCTGGCAACAGGCCGCCAGC
CCACCACGGAGCACGCAGCGCCCTGGATCCCCGACAAGGCAACGGACATCTGCATGCGCTGCAC
GCAGACACGCTTCTCGGCGCTCACCCGGCGTCACCACTGCCGCAAATGCGGGTTTGTGGTCTGT
GCTGAGTGTTCCAGGGAGCGTTTCCTGTTGCCACGTCTCTCCCCCAAGCCCCTTCGTGTCTGCA
GCCTCTGCTACCGAGAGCTGGCCGCCCAGAAGCGGAGGGAGGAGGCCAAGGAGAGGTTCAGGGG
CTCTCCGGGGCAGCTGACCCACCTAGGCAGCACCATGTGTGGTGCGTCCAGTGGCGATGACGAT
GACTCCGATGAGGACAGAGAGGGCAGTGGAGATGGTGACTGGCCCACCCAGGTGGAGTTCTATG
CTTCTGGTGTCTCCTGGTCAGCCTTCCATAGTTGACCCTCACCTGCAGAGTGCCTCAAGCCAGC
CCTCTGCCGGGGATCCTTGCCCACGGTAGTGGGCATGTGACCGGTGGCTGTTCCAGAGCCATTA
CTAGAGCCTTTCTGCTAGGCAGCAGCTCCTAGGCCCTCTTCTAATTCTTTTCAGAGAATTTCCT
TTCCATTTCACAAGCTACAGCTGCAACCCTTGGAGTTAGACCAGGCCAGGTGTGCCCCAAGCAT
TAAGTTGGGAGTTGAAAAGGGCAAAGGGAAGGCCAGACCAGAACTGGGGGGGGGGTCCACTTCA
ACTCTGAAGCTGGGGCTCCAGACCCCACTCCCACCTCCAACTCCTAACAGGTACAGCTGTCGGG
AGGGCATGAGGCTGCACATCTACCATGCAGATGCCACCACCTGGCCACTGGGTCGTGCCAAGCT
GGACCCAGATGTACAGTGTGTACCCTCCAGGCCAGCCCATCGAGGTCTCTGCCCTGTCACTACC
AAGTGTCTGGTGTCTGTGTGTCCTGTCCCCATCTCTGTCTGTGGTCAGTAGAATCAGTGTTTTC
TCTTAGGACTCTAGGTTCAGGGACAAAAACCCTATCCAGACTGATTTATCAATAAACAAAAATG
AAATACCAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001013166	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79354	(Get FASTA)	NCBI Sequence Viewer
	EDM07589	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000020352.3
	ENSRNOP00000081760.1
	ENSRNOP00000091851.1
	ENSRNOP00065045780
	ENSRNOP00065045785
	ENSRNOP00065045793
GenBank Protein	Q68FU1	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001013166 ⟸ NM_001013148

- UniProtKB:

Q68FU1 (UniProtKB/Swiss-Prot), A6JAE5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVDHLANTEINSQRIAAVENCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFNDILVY
GSIVLSKRKYRSQHIIPLEEVTLEPLPETLQAKNRWMIKTAKKSFVVSAASTTERQEWISHIEE
CVRRQLLATGRQPTTEHAAPWIPDKATDICMRCTQTRFSALTRRHHCRKCGFVVCAECSRERFL
LPRLSPKPLRVCSLCYRELAAQKRREEAKERFRGSPGQLTHLGSTMCGASSGDDDDSDEDREGS
GDGDWPTQVEFYASGVSWSAFHS

hide sequence

Ensembl Acc Id:

ENSRNOP00000020352 ⟸ ENSRNOT00000020383

Ensembl Acc Id:

ENSRNOP00000081760 ⟸ ENSRNOT00000108120

Ensembl Acc Id:

ENSRNOP00000091851 ⟸ ENSRNOT00000113101

Protein Domains

FYVE-type PH

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q68FU1-F1-model_v2	AlphaFold	Q68FU1	1-279	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310544	AgrOrtholog
BioCyc Gene	G2FUF-59935	BioCyc
Ensembl Genes	ENSRNOG00000027724	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00065032307	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000020383.6	UniProtKB/Swiss-Prot
	ENSRNOT00000108120.1	UniProtKB/Swiss-Prot
	ENSRNOT00000113101.1	UniProtKB/Swiss-Prot
	ENSRNOT00065055614	UniProtKB/Swiss-Prot
	ENSRNOT00065055619	UniProtKB/Swiss-Prot
	ENSRNOT00065055627	UniProtKB/Swiss-Prot
Gene3D-CATH	2.30.29.30	UniProtKB/Swiss-Prot
	3.30.40.10	UniProtKB/Swiss-Prot
	Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)	UniProtKB/TrEMBL
	Zinc/RING finger domain, C3HC4 (zinc finger)	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7108247	IMAGE-MGC_LOAD
InterPro	PH-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PH_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PH_domain-containing_F	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PH_Phafin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PKHF1_FYVE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Znf_FYVE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Znf_FYVE-rel	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Znf_FYVE_PHD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Znf_RING/FYVE/PHD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:308543	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:94811	IMAGE-MGC_LOAD
NCBI Gene	308543	ENTREZGENE
PANTHER	PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING FAMILY F MEMBER 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING FAMILY F MEMBER 2-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	FYVE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PF00169	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Plekhf1	PhenoGen
PROSITE	PH_DOMAIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZF_FYVE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000027724	RatGTEx
	ENSRNOG00065032307	RatGTEx
SMART	FYVE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SM00233	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	FYVE/PHD zinc finger	UniProtKB/TrEMBL
	PH domain-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF57903	UniProtKB/Swiss-Prot
UniProt	A6JAE5	ENTREZGENE, UniProtKB/TrEMBL
	PKHF1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-30	Plekhf1	pleckstrin homology and FYVE domain containing 1	Plekhf1	pleckstrin homology domain containing, family F (with FYVE domain) member 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Plekhf1	pleckstrin homology domain containing, family F (with FYVE domain) member 1	Plekhf1_predicted	pleckstrin homology domain containing, family F (with FYVE domain) member 1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Plekhf1_predicted	pleckstrin homology domain containing, family F (with FYVE domain) member 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD