Isg15 (ISG15 ubiquitin-like modifier)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Isg15 (ISG15 ubiquitin-like modifier) Rattus norvegicus

Analyze

Symbol:

Isg15

Name:

ISG15 ubiquitin-like modifier

RGD ID:

1310312

Description:

Predicted to enable integrin binding activity; protein tag; and ubiquitin protein ligase binding activity. Predicted to be involved in several processes, including ISG15-protein conjugation; defense response to other organism; and positive regulation of cytokine production. Predicted to act upstream of or within response to bacterium. Predicted to be located in extracellular region. Predicted to be active in cytoplasm and nucleus. Human ortholog(s) of this gene implicated in immunodeficiency 38. Orthologous to human ISG15 (ISG15 ubiquitin like modifier); PARTICIPATES IN Retinoic acid-inducible gene (RIG) I-like receptor signaling pathway; INTERACTS WITH 1,2-dimethylhydrazine; 17alpha-ethynylestradiol; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

G1p2; interferon, alpha-inducible protein (clone IFI-15K); LOC298693; ubiquitin-like protein ISG15

RGD Orthologs

Human

Mouse

Chinchilla

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ISG15 (ISG15 ubiquitin like modifier)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Isg15 (ISG15 ubiquitin-like modifier)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Isg15 (ISG15 ubiquitin like modifier)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ISG15 (ISG15 ubiquitin like modifier)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Isg15 (ISG15 ubiquitin like modifier)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ISG15 (ISG15 ubiquitin like modifier)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ISG15 (ISG15 ubiquitin like modifier)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Isg15 (ISG15 ubiquitin like modifier)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ISG15 (ISG15 ubiquitin like modifier)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Isg15 (ISG15 ubiquitin-like modifier)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	isg15 (ISG15 ubiquitin-like modifier)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	166,784,148 - 166,785,435 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	166,784,148 - 166,785,435 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	169,486,258 - 169,487,543 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	171,307,649 - 171,308,934 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	171,270,210 - 171,271,495 (-)	NCBI	Rnor_WKY
Rnor_6.0	5	173,624,862 - 173,629,124 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	173,624,310 - 173,626,248 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	177,098,640 - 177,102,838 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	173,034,479 - 173,035,766 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	173,031,293 - 173,045,496 (-)	NCBI
Celera	5	164,983,801 - 164,985,088 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

chromosome 1p36 deletion syndrome (ISO)

Chronic Hepatitis C (ISO)

congenital myasthenic syndrome 8 (ISO)

COVID-19 (ISO)

Ehlers-Danlos syndrome spondylodysplastic type 2 (ISO)

Experimental Diabetes Mellitus (IEP)

genetic disease (ISO)

hepatocellular carcinoma (ISO)

Human Influenza (ISO)

idiopathic generalized epilepsy (ISO)

immunodeficiency 16 (ISO)

immunodeficiency 38 (ISO)

Joubert syndrome 25 (ISO)

major depressive disorder (ISO)

Neurodevelopmental Disorders (ISO)

Peroxisome Biogenesis Disorder, Complementation Group 7 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

(S)-nicotine (ISO)

1,2-dimethylhydrazine (EXP,ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrobenzenesulfonic acid (ISO)

2-butoxyethanol (ISO)

2-hydroxypropanoic acid (ISO)

3,3',5,5'-tetrabromobisphenol A (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (EXP,ISO)

4-hydroxynon-2-enal (ISO)

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

6alpha-methylprednisolone (ISO)

7,12-dimethyltetraphene (ISO)

acetamide (EXP)

Actein (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alvocidib (ISO)

aristolochic acid A (ISO)

arsenous acid (ISO)

azathioprine (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-naphthoflavone (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

chlordecone (ISO)

chloroprene (EXP)

cholesterol (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

clofibrate (ISO)

cobalt dichloride (ISO)

copper atom (EXP)

copper(0) (EXP)

Cuprizon (EXP)

cyclophosphamide (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

dexamethasone (ISO)

diarsenic trioxide (ISO)

diazinon (EXP)

dichloroacetic acid (ISO)

diclofenac (ISO)

dieldrin (EXP)

diethyl malate (ISO)

diethylstilbestrol (ISO)

dimethyl sulfoxide (ISO)

dioxygen (EXP)

doxorubicin (ISO)

endosulfan (EXP)

entinostat (ISO)

ethyl methanesulfonate (ISO)

etoposide (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

furan (EXP)

Genipin (ISO)

genistein (ISO)

gentamycin (EXP)

GW 4064 (ISO)

hydroquinone (ISO)

indometacin (ISO)

ivermectin (ISO)

lipopolysaccharide (ISO)

lipoteichoic acid (ISO)

mercury atom (ISO)

mercury(0) (ISO)

metam (ISO)

methotrexate (ISO)

methyl methanesulfonate (ISO)

mitoxantrone (ISO)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

N-methyl-4-phenylpyridinium (ISO)

nickel atom (ISO)

nickel dichloride (EXP)

nicotine (ISO)

orphenadrine (EXP)

oxaliplatin (EXP)

ozone (ISO)

paclitaxel (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

pentanal (ISO)

phenylephrine (EXP)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (ISO)

piroxicam (ISO)

poly(I:C) (ISO)

prednisolone (ISO)

propanal (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

rotenone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

senecionine (ISO)

serpentine asbestos (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sodium aurothiomalate (ISO)

sodium dichromate (EXP)

Soman (EXP)

succimer (ISO)

sunitinib (ISO)

tamibarotene (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (EXP)

testosterone enanthate (ISO)

tetrachloroethene (ISO)

tetrachloromethane (EXP)

tetraphene (ISO)

thapsigargin (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

tofacitinib (ISO)

toluene 2,4-diisocyanate (ISO)

topotecan (EXP,ISO)

trimellitic anhydride (EXP)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

XL147 (ISO)

zidovudine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

defense response to bacterium (ISO)

defense response to virus (ISO)

innate immune response (ISO)

integrin-mediated signaling pathway (ISO)

ISG15-protein conjugation (IBA,ISO)

modification-dependent protein catabolic process (IBA,ISO)

negative regulation of protein ubiquitination (ISO)

negative regulation of type I interferon-mediated signaling pathway (ISO)

negative regulation of viral genome replication (ISO)

positive regulation of bone mineralization (ISO)

positive regulation of erythrocyte differentiation (ISO)

positive regulation of interferon-beta production (ISO)

positive regulation of interleukin-10 production (ISO)

positive regulation of protein oligomerization (ISO)

positive regulation of type II interferon production (ISO)

post-translational protein targeting to endoplasmic reticulum membrane (IEA)

protein localization to mitochondrion (ISO)

protein ubiquitination (IBA)

regulation of type II interferon production (ISO)

response to bacterium (ISO)

response to type I interferon (ISO)

response to virus (ISO)

Cellular Component

cytosol (IEA)

extracellular region (ISO)

Molecular Function

integrin binding (ISO)

protein binding (ISO)

protein tag (IBA,ISO)

ubiquitin protein ligase binding (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

Retinoic acid-inducible gene (RIG) I-like receptor signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Differential gene expression pattern of diabetic rat retinas after intravitreal injection of erythropoietin.	Chu Q, etal., Clin Experiment Ophthalmol. 2011 Mar;39(2):142-51. doi: 10.1111/j.1442-9071.2010.02437.x.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Hepatic IFNL4 expression is associated with non-response to interferon-based therapy through the regulation of basal interferon-stimulated gene expression in chronic hepatitis C patients.	Murakawa M, etal., J Med Virol. 2017 Jul;89(7):1241-1247. doi: 10.1002/jmv.24763. Epub 2017 Feb 27.
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:15485925	PMID:16122702	PMID:16139798	PMID:17227866	PMID:18305167	PMID:19357168	PMID:21402791	PMID:21543490	PMID:22022510	PMID:22859821	PMID:23012479	PMID:29100055
PMID:30826466	PMID:31505169

Genomics

Comparative Map Data

Isg15
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	166,784,148 - 166,785,435 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	166,784,148 - 166,785,435 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	169,486,258 - 169,487,543 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	171,307,649 - 171,308,934 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	171,270,210 - 171,271,495 (-)	NCBI	Rnor_WKY
Rnor_6.0	5	173,624,862 - 173,629,124 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	173,624,310 - 173,626,248 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	177,098,640 - 177,102,838 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	173,034,479 - 173,035,766 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	173,031,293 - 173,045,496 (-)	NCBI
Celera	5	164,983,801 - 164,985,088 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

ISG15
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	1,013,497 - 1,014,540 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	1	1,001,138 - 1,014,540 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	948,877 - 949,920 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	938,742 - 939,782 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	988,945 - 989,986	NCBI
Celera	1	1,639,488 - 1,640,561 (-)	NCBI		Celera
Cytogenetic Map	1	p36.33	NCBI
HuRef	1	220,321 - 221,394 (+)	NCBI		HuRef
CHM1_1	1	935,863 - 936,936 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	443,628 - 444,671 (+)	NCBI		T2T-CHM13v2.0

Isg15
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	156,283,881 - 156,285,275 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	156,283,912 - 156,285,253 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	156,199,424 - 156,200,818 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	156,199,455 - 156,200,796 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	155,573,533 - 155,574,927 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	155,573,561 - 155,574,905 (-)	NCBI		MGSCv36	mm8
Celera	4	158,455,875 - 158,457,269 (-)	NCBI		Celera
Cytogenetic Map	4	E2	NCBI

Isg15
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955486	9,706,703 - 9,707,949 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955486	9,706,878 - 9,707,876 (-)	NCBI	ChiLan1.0	ChiLan1.0

ISG15
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	56,230,879 - 56,237,354 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	56,236,318 - 56,404,695 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	56,314,175 - 56,315,328 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	56,439,681 - 56,440,834 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	56,439,798 - 56,607,588 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	56,430,725 - 56,431,878 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	56,322,629 - 56,323,782 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	56,712,681 - 56,713,834 (+)	NCBI		UU_Cfam_GSD_1.0

Isg15
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	27,421,189 - 27,422,563 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936737	2,043,383 - 2,044,761 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ISG15
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	63,363,173 - 63,364,208 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	63,363,201 - 63,364,211 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

ISG15
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	130,419,909 - 130,421,409 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	130,419,782 - 130,421,380 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666054	35,047,518 - 35,049,231 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Isg15
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624818	8,510,657 - 8,511,749 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Isg15
3 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	36
Count of miRNA genes:	33
Interacting mature miRNAs:	33
Transcripts:	ENSRNOT00000039263
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	143069996	166846814	Rat
631272	Lanf1	Left ventricular atrial natriuretic factor QTL 1	12		heart left ventricle natriuretic peptide A amount (VT:0010596)	heart left ventricle natriuretic peptide A level (CMO:0002165)	5	151113452	166875058	Rat
1549904	Neuinf1	Neuroinflammation QTL 1	3	0	nervous system integrity trait (VT:0010566)	blood T lymphocyte count (CMO:0000110)	5	154828214	166875058	Rat

Markers in Region

RH135070

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	166,784,161 - 166,784,343 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	173,624,916 - 173,625,097	NCBI	Rnor6.0
Rnor_5.0	5	177,098,694 - 177,098,875	UniSTS	Rnor5.0
RGSC_v3.4	5	173,034,493 - 173,034,674	UniSTS	RGSC3.4
Celera	5	164,983,815 - 164,983,996	UniSTS
RH 3.4 Map	5	1171.5	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		2	16	5	16	5				5	6	10
Low	3	25	25	20	3	20	8	11	43	18	33	1	8
Below cutoff		16	16	16		16			31	12	2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106700	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006239563	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC097183	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000039263 ⟹ ENSRNOP00000035405

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	5	173,624,310 - 173,626,248 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000096620 ⟹ ENSRNOP00000090709

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	166,784,148 - 166,785,435 (-)	Ensembl

RefSeq Acc Id:

NM_001106700 ⟹ NP_001100170

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	166,784,148 - 166,785,435 (-)	NCBI
Rnor_6.0	5	173,624,902 - 173,626,189 (-)	NCBI
Rnor_5.0	5	177,098,640 - 177,102,838 (-)	NCBI
RGSC_v3.4	5	173,034,479 - 173,035,766 (-)	RGD
Celera	5	164,983,801 - 164,985,088 (-)	RGD

Sequence:

show sequence

ACATCCACAGCTCAGACTTTAAGAGAGCTGACCCAGTGAGTCTCTCTCTGACTGTGAGAGCCAG
CAGCCAGAAGCTGAGAGAAGCAGAGAGAAGCAGACTCCTTAGTTTCAGGGGACCTAGTGCTAAA
GCCTACAGCCATGACCTGGAACCTAAAGGTGAAGATGCTGGGGGGCAAGGAGTTCCTGGTGTCC
ATGACAAACTCCATGATGCTGTCAGAACTGAAGAAGCAGGTTGCTCAGAAGAGTGGTGTGCCAG
CTTTCCAGCAGCGCCTGGCCCACCAAAGCGGTGAAATGCTACAGGATGGTGTTGCCCTTATCAG
GCAGGGCCTTAGTTCTGGCAGCACAGTCATGCTGATGGTAGAGAACTGCAGCCATCCTCTGAGC
ATCCTGGTGAGGAATGAAAGGGGCCGCAGCAATGTCTATGAGGTCCAGCTGACACAGACTGTGG
AAGTGCTTATGAGGCAGGTGTCCCAGCACGAGCAAGTCTCCCAAGACCAATTCTGGCTGAGCTT
CAACGGAAGGCCCATGGAGGACAAAGAGCCACTGGGGGAGTATGGCCTAACACCCCACTGCACA
GTGATCATGAATTTGCGCCTGAGGGGGGGAGGGGACTACTATTTCTAAGGCCCCTATCCAGAGC
CAATGTAGGTAATAAAAGACAAT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001100170	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL81366	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001100170 ⟸ NM_001106700
- UniProtKB:	D4A3X3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTWNLKVKMLGGKEFLVSMTNSMMLSELKKQVAQKSGVPAFQQRLAHQSGEMLQDGVALIRQGL SSGSTVMLMVENCSHPLSILVRNERGRSNVYEVQLTQTVEVLMRQVSQHEQVSQDQFWLSFNGR PMEDKEPLGEYGLTPHCTVIMNLRLRGGGDYYF hide sequence

RefSeq Acc Id:

ENSRNOP00000035405 ⟸ ENSRNOT00000039263

RefSeq Acc Id:

ENSRNOP00000090709 ⟸ ENSRNOT00000096620

Protein Domains

Ubiquitin-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A3X3-F1-model_v2	AlphaFold	D4A3X3	1-161	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694345

Promoter ID:

EPDNEW_R4869

Type:

multiple initiation site

Name:

Isg15_1

Description:

ISG15 ubiquitin-like modifier

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	173,626,140 - 173,626,200	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310312	AgrOrtholog
BioCyc Gene	G2FUF-38859	BioCyc
Ensembl Genes	ENSRNOG00000021802	Ensembl
	ENSRNOG00000069527	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000090709	ENTREZGENE
	ENSRNOP00000090709.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000096620	ENTREZGENE
	ENSRNOT00000096620.1	UniProtKB/TrEMBL
InterPro	Ubiquitin	UniProtKB/TrEMBL
	Ubiquitin-rel_dom	UniProtKB/TrEMBL
NCBI Gene	298693	ENTREZGENE
PANTHER	UBIQUITIN-LIKE PROTEIN 4A	UniProtKB/TrEMBL
	UBIQUITIN-LIKE PROTEIN 4A	UniProtKB/TrEMBL
Pfam	ubiquitin	UniProtKB/TrEMBL
PhenoGen	Isg15	PhenoGen
PROSITE	UBIQUITIN_2	UniProtKB/TrEMBL
SMART	UBQ	UniProtKB/TrEMBL
Superfamily-SCOP	SSF54236	UniProtKB/TrEMBL
UniProt	D4A3X3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2010-04-20	Isg15	ISG15 ubiquitin-like modifier	G1p2	interferon, alpha-inducible protein (clone IFI-15K)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	G1p2	interferon, alpha-inducible protein (clone IFI-15K)	G1p2_predicted	interferon, alpha-inducible protein (clone IFI-15K) (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	G1p2_predicted	interferon, alpha-inducible protein (clone IFI-15K) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)