Perp (p53 apoptosis effector related to PMP22)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Perp (p53 apoptosis effector related to PMP22) Rattus norvegicus

Analyze

Symbol:

Perp

Name:

p53 apoptosis effector related to PMP22

RGD ID:

1310294

Description:

Predicted to be involved in activation of cysteine-type endopeptidase activity and cell-cell adhesion. Predicted to act upstream of or within several processes, including amelogenesis; desmosome organization; and intrinsic apoptotic signaling pathway by p53 class mediator. Predicted to be located in Golgi apparatus; mitochondrion; and plasma membrane. Predicted to be active in cell-cell junction. Human ortholog(s) of this gene implicated in erythrokeratodermia variabilis and mutilating palmoplantar keratoderma with periorificial keratotic plaques. Orthologous to human PERP (p53 apoptosis effector related to PMP22); PARTICIPATES IN p53 signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC292949; p53 apoptosis effector related to PMP-22; PERP, TP53 apoptosis effector

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PERP (p53 apoptosis effector related to PMP22)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Perp (PERP, TP53 apoptosis effector)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Perp (p53 apoptosis effector related to PMP22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PERP (p53 apoptosis effector related to PMP22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PERP (p53 apoptosis effector related to PMP22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Perp (p53 apoptosis effector related to PMP22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PERP (p53 apoptosis effector related to PMP22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PERP (p53 apoptosis effector related to PMP22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Perp (p53 apoptosis effector related to PMP22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PERP (p53 apoptosis effector related to PMP22)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Perp (PERP, TP53 apoptosis effector)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	perp (p53 apoptosis effector related to pmp22)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG45049	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	vab-9	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	perp	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	13,542,067 - 13,554,514 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	13,542,067 - 13,554,511 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	13,309,957 - 13,322,172 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	1	19,311,879 - 19,324,094 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	1	13,522,288 - 13,534,734 (+)	NCBI	Rnor_WKY
Rnor_6.0	1	14,224,392 - 14,236,838 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	14,224,393 - 14,236,846 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	15,786,756 - 15,799,202 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	13,976,356 - 13,988,803 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	13,976,417 - 13,988,865 (+)	NCBI
Celera	1	11,994,747 - 12,007,193 (+)	NCBI		Celera
Cytogenetic Map	1	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Erythrokeratodermia Variabilis et Progressiva 7 (ISO)

familial Behcet-like autoinflammatory syndrome (ISO)

genetic disease (ISO)

Olmsted Syndrome 2 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2-acetamidofluorene (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

alvocidib (ISO)

amphetamine (EXP)

antirheumatic drug (ISO)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

Benzo[k]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

chromium atom (ISO)

cisplatin (ISO)

cobalt atom (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

diazinon (EXP)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

enzalutamide (ISO)

etoposide (ISO)

finasteride (EXP)

flutamide (EXP,ISO)

folic acid (ISO)

glafenine (EXP)

hydrogen peroxide (ISO)

hydroxyurea (ISO)

leflunomide (EXP)

lipopolysaccharide (ISO)

menadione (ISO)

mercury dibromide (ISO)

methotrexate (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

mitomycin C (ISO)

N-methyl-N-nitrosourea (ISO)

N-nitrosodiethylamine (ISO)

nickel sulfate (ISO)

nitrofen (EXP)

Nutlin-3 (ISO)

ozone (ISO)

p-chloromercuribenzoic acid (ISO)

paclitaxel (ISO)

paracetamol (ISO)

paraquat (EXP)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

pyrazinecarboxamide (EXP)

quercetin (ISO)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

trovafloxacin (EXP)

Tungsten carbide (ISO)

urethane (ISO)

ursodeoxycholic acid (EXP)

valproic acid (ISO)

WIN 55212-2 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

activation of cysteine-type endopeptidase activity (ISO)

amelogenesis (ISO)

cell-cell adhesion (IBA)

desmosome organization (ISO)

heterotypic cell-cell adhesion (ISO)

intrinsic apoptotic signaling pathway by p53 class mediator (ISO)

Notch signaling pathway (ISO)

positive regulation of proteolysis (ISO)

Cellular Component

cell-cell junction (IBA)

Golgi apparatus (ISO)

mitochondrion (ISO)

plasma membrane (ISO)

Molecular Function

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

p53 signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10733530	PMID:12477932	PMID:14651853	PMID:18387192	PMID:21285247	PMID:23117660

Genomics

Comparative Map Data

Perp
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	13,542,067 - 13,554,514 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	13,542,067 - 13,554,511 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	13,309,957 - 13,322,172 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	1	19,311,879 - 19,324,094 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	1	13,522,288 - 13,534,734 (+)	NCBI	Rnor_WKY
Rnor_6.0	1	14,224,392 - 14,236,838 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	14,224,393 - 14,236,846 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	15,786,756 - 15,799,202 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	13,976,356 - 13,988,803 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	13,976,417 - 13,988,865 (+)	NCBI
Celera	1	11,994,747 - 12,007,193 (+)	NCBI		Celera
Cytogenetic Map	1	p12	NCBI

PERP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	138,088,505 - 138,107,419 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	6	138,088,505 - 138,107,419 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	138,409,642 - 138,428,556 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	138,453,619 - 138,470,280 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	138,453,618 - 138,470,280	NCBI
Celera	6	139,149,757 - 139,168,773 (-)	NCBI		Celera
Cytogenetic Map	6	q23.3	NCBI
HuRef	6	135,971,089 - 135,990,120 (-)	NCBI		HuRef
CHM1_1	6	138,671,982 - 138,691,001 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	139,276,972 - 139,295,905 (-)	NCBI		T2T-CHM13v2.0

Perp
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	18,720,819 - 18,732,821 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	18,720,768 - 18,732,821 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	18,845,071 - 18,857,073 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	18,845,020 - 18,857,073 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	18,564,877 - 18,576,879 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	18,534,487 - 18,546,489 (+)	NCBI		MGSCv36	mm8
Celera	10	18,748,886 - 18,761,084 (+)	NCBI		Celera
Cytogenetic Map	10	A3	NCBI

Perp
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955436	21,417,332 - 21,431,312 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955436	21,425,321 - 21,430,780 (+)	NCBI	ChiLan1.0	ChiLan1.0

PERP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	6	155,949,703 - 155,967,511 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	135,845,845 - 135,863,603 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	139,931,031 - 139,947,785 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	139,931,031 - 139,947,792 (-)	Ensembl	panpan1.1		panPan2

PERP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	30,418,847 - 30,435,287 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	30,419,963 - 30,435,859 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	31,302,107 - 31,318,554 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	30,586,637 - 30,602,974 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	30,586,649 - 30,603,057 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	30,465,332 - 30,481,655 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	30,346,928 - 30,363,397 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	30,655,974 - 30,672,424 (-)	NCBI		UU_Cfam_GSD_1.0

Perp
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	125,505,855 - 125,522,032 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936560	5,284,612 - 5,301,478 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936560	5,285,071 - 5,301,253 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PERP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	26,301,252 - 26,317,868 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	26,301,254 - 26,317,046 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	29,555,756 - 29,574,041 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PERP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	35,305,552 - 35,322,112 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	35,305,678 - 35,322,099 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	7,499,793 - 7,516,318 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Perp
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624753	15,772,083 - 15,786,794 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624753	15,772,104 - 15,786,238 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Perp
112 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	113
Count of miRNA genes:	88
Interacting mature miRNAs:	96
Transcripts:	ENSRNOT00000016037
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354647	Despr8	Despair related QTL 8		0.0000341	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	1	24744506	Rat
2298546	Neuinf4	Neuroinflammation QTL 4	5.1		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	1	1	28736750	Rat
2313053	Bss51	Bone structure and strength QTL 51	3.8	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	1	32356093	Rat
2313070	Bss52	Bone structure and strength QTL 52	4.4	0.0001	body length (VT:0001256)	body length (CMO:0000013)	1	1	32356093	Rat
2313090	Bmd69	Bone mineral density QTL 69	4.4	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	1	32356093	Rat
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1578650	Bmd6	Bone mineral density QTL 6	12.2		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	1	509108	43284926	Rat
1578651	Bmd7	Bone mineral density QTL 7	14.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	1	509108	43284926	Rat
1578669	Bss9	Bone structure and strength QTL 9	6.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	1	509108	43284926	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
1600360	Mcs16	Mammary carcinoma susceptibility QTL 16	2.4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	2244390	43433040	Rat
7421626	Bp360	Blood pressure QTL 360		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	4393289	49393289	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
4889451	Eae29	Experimental allergic encephalomyelitis QTL 29	5.51		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	1	5925877	24697545	Rat
631508	Sald1	Serum aldosterone level QTL 1	3.7		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	1	9856001	54856001	Rat
2302038	Pia31	Pristane induced arthritis QTL 31	5.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	1	10992065	55992065	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2317755	Glom22	Glomerulus QTL 22	3.8		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	1	11481482	32355910	Rat
1578756	Iddm22	Insulin dependent diabetes mellitus QTL 22	2.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	11835181	56835181	Rat

Markers in Region

RH128721

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	13,554,273 - 13,554,469 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	14,236,598 - 14,236,793	NCBI	Rnor6.0
Rnor_5.0	1	15,798,962 - 15,799,157	UniSTS	Rnor5.0
RGSC_v3.4	1	13,988,563 - 13,988,758	UniSTS	RGSC3.4
Celera	1	12,006,953 - 12,007,148	UniSTS
RH 3.4 Map	1	132.4	UniSTS
Cytogenetic Map	1	p12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	41	33	8	33			2	35	14	11
Low			15	8	11	8	5	5	68		27		5
Below cutoff			1				3	4	4				3

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106265	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC166608	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473994	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000016037 ⟹ ENSRNOP00000016037

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	13,542,067 - 13,554,511 (+)	Ensembl
Rnor_6.0 Ensembl	1	14,224,393 - 14,236,846 (+)	Ensembl

RefSeq Acc Id:

NM_001106265 ⟹ NP_001099735

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	13,542,067 - 13,554,514 (+)	NCBI
Rnor_6.0	1	14,224,392 - 14,236,838 (+)	NCBI
Rnor_5.0	1	15,786,756 - 15,799,202 (+)	NCBI
RGSC_v3.4	1	13,976,356 - 13,988,803 (+)	RGD
Celera	1	11,994,747 - 12,007,193 (+)	RGD

Sequence:

show sequence

GCGGGAGCCGCCTCTTCCTTTAGTGGCGGTGTCGGCGCTCGCAGGACCACTCTCGGCCGCTGCT
CCAGCCCCGCGTTCCTCCGCTCCGCGCCGCCACCGACGACATGCTGCGCTGCGGCCTGGCCTGC
GAGCGCTGCAGGTGGATCCTGCCCCTGCTGCTGCTCAGTGCCATCGCCTTCGACATCATCGCGC
TGTCCGGCCGCGGCTGGCTGCAGTCTAGCAACCACATCCAGACGTCCTCGCTTTGGTGGAGGTG
TTTCGACGAGGGCGGTGGCAGCGGCTCCTACGACGATGGCTGCCAGAGCCTCATGGAATACGCC
TGGGGCCGAGCAGCTGCTGCCACTCTCTTCTGTGGATTCATCATCCTGGTCATCTGCTTCATCC
TCTCGTTCTTCGCCCTGTGTGGACCCCAGATGCTTGTTTTCCTGAGAGTGATTGGAGGCCTTCT
CGCACTGGCTGCTGTATTCCAGATCATCTCCCTGGTTATCTATCCCGTGAAGTACACACAAACC
TTCAGGCTTCATGATAATCCCGCTGTTAATTACATCTACAACTGGGCCTATGGCTTCGGATGGG
CAGCCACGATCATCTTGATTGGTTGCTCTTTCTTCTTCTGCTGCCTCCCCAACTACGAGGATGA
CCTTCTGGGCAATGCAAAGCCCAGGTACTTCTATACATCTGCCTAATGTGGAGGGAGATCCTGA
GAAAAGCCTGCTGCAAGATGCATGTGAGGAGGAAAGTGTTCTCCAAGGAGCAAAGAACCTATGT
TTGGGCAGTGTTCATATGAGTGGAAATGCTAGAATAAATGCTAAAGAAAATTCTTCATAAATAG
TGTTAAGTTTCATGTCCCTGTGTATGTCTTGCGGAGTTAAAAGAGACTTGTTTCTGTTTGCTCA
GTATATGCTGACTTCTCCTTGCACCAATTCTGTATCATTTAAACTTCATTTGTTAAAGAGCATG
CCCGGGAAACTTGCTAAGTAAGAAATGCTATGGCTTCTCATTTAATAATCTGATGAAGCTTTTG
TTTTTCCAGAGAGAATGGGTTGTTTCTACAGGGAATGGGTTGGCTACAGAGCAGGAAAGCTACT
GGCAAATTCCAGTGACCAAATATTCTGAAATTAATGTTTTTCTTAAACACACACACACACACAC
ACACACACACACACACACACACACACACACGCCCTTTTTGAGTTTTCAGTTACATAAAGAAGCA
GAGTGGTGTCCTACGTGAGCATCGATGTTTTGAACAGTTATTGTTTCGCTCAGCTTTGTGTTGA
TTTTCTCCGATATGCGGGGAAAGTGAAACATGGCCGTTGTCACTACTGAATGCTAAGGTGAATT
TTACTCTTTTGACGTAGATTAGAGGGGTGGGTGTGGGAAGAAGCCATATTAACAAATCTGTACA
GTGTTGCGTGTATGTTTAGAACCAGCGTAGACTAGATGGGAGGGTGGACTAGGCCTTATTCCTC
CCGACCGATGGATGTGATGAGGTCGGGTAGGAAGGCCTATGAGGGTTACCATTCAGACATCCCG
GGAGAAGACATATCAATGCCCCTCTCAGCCTTAACTGAGCTCTACTGACAGACAGCTAGAATAG
ATTTGAACTGTAACAGAAACCTAAATGTAATTACAAACCTGGTCTTCCTCGGTAAACAGACTTA
ACATATCTGTATAATACATACAAGGGGGAAATTTGGGAATGAGTTTCTCTGAATACATATTGGA
AGGGCTGTTATTATTTTTTCTTACCATTTATACTCACTGAATGGAAACTAGCTTATTTTAAATA
TCAGAACACTATTTTGTAAGTTGCAGCCAAGACAATTGCAGTTTTCATGACCAGCTTCCCCAAT
AAACCAGATGTTCAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099735	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI66608	(Get FASTA)	NCBI Sequence Viewer
	EDL93779	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001099735 ⟸ NM_001106265
- UniProtKB:	B2GVC0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLRCGLACERCRWILPLLLLSAIAFDIIALSGRGWLQSSNHIQTSSLWWRCFDEGGGSGSYDDG CQSLMEYAWGRAAAATLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVI YPVKYTQTFRLHDNPAVNYIYNWAYGFGWAATIILIGCSFFFCCLPNYEDDLLGNAKPRYFYTS A hide sequence

RefSeq Acc Id:

ENSRNOP00000016037 ⟸ ENSRNOT00000016037

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2GVC0-F1-model_v2	AlphaFold	B2GVC0	1-193	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689508

Promoter ID:

EPDNEW_R33

Type:

initiation region

Name:

Perp_1

Description:

PERP, TP53 apoptosis effector

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	14,224,413 - 14,224,473	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310294	AgrOrtholog
BioCyc Gene	G2FUF-62252	BioCyc
Ensembl Genes	ENSRNOG00000011994	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000016037	ENTREZGENE
	ENSRNOP00000016037.4	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000016037	ENTREZGENE
	ENSRNOT00000016037.7	UniProtKB/TrEMBL
Gene3D-CATH	1.20.140.150	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5599021	IMAGE-MGC_LOAD
InterPro	P53_induced	UniProtKB/TrEMBL
	PMP22/EMP/MP20/Claudin	UniProtKB/TrEMBL
KEGG Report	rno:292949	UniProtKB/TrEMBL
MGC_CLONE	MGC:188392	IMAGE-MGC_LOAD
NCBI Gene	292949	ENTREZGENE
PANTHER	P53 APOPTOSIS EFFECTOR RELATED TO PMP-22	UniProtKB/TrEMBL
	P53_induced	UniProtKB/TrEMBL
Pfam	PMP22_Claudin	UniProtKB/TrEMBL
PhenoGen	Perp	PhenoGen
UniProt	B2GVC0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2020-08-13	Perp	p53 apoptosis effector related to PMP22	Perp	PERP, TP53 apoptosis effector	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Perp	PERP, TP53 apoptosis effector	Perp_predicted	PERP, TP53 apoptosis effector (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Perp_predicted	PERP, TP53 apoptosis effector (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)