Predicted to be involved in several processes, including CENP-A containing nucleosome assembly; apoptotic process; and regulation of transcription, DNA-templated. Predicted to localize to nucleoplasm. Orthologous to human ITGB3BP (integrin subunit beta 3 binding protein); INTERACTS WITH acetamide; bisphenol A; diuron.
[bisphenol A binds to and affects the folding of AR protein] affects the reaction [AR protein modified form binds to ITGB3BP protein modified form], bisphenol A inhibits the reaction [ESR1 protein binds to ITGB3BP protein]
[Cyproterone Acetate binds to and affects the folding of AR protein] promotes the reaction [AR protein modified form binds to ITGB3BP protein modified form]
MLNLVEDNTCPILIERVKRSLKLDDQFEENSFGPSKIMRKKSITAFSPTTGTYQLSPFSSPRTP KEQEHRDGPSNGTRKWSVLSSPARQDSTVKGSDGFMMLLSKIERSSEKTMEIMKNLSSLQALEG NRQLEDLLGVSLVPCSLKSEAKKTKELMTKVMKQKLFEKKNSRIPPKVLPSSLTTVSTYLDTSQ P
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin