Tnnc1 (troponin C1, slow skeletal and cardiac type)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Tnnc1 (troponin C1, slow skeletal and cardiac type) Rattus norvegicus

Analyze

Symbol:

Tnnc1

Name:

troponin C1, slow skeletal and cardiac type

RGD ID:

1309921

Description:

Enables calcium ion binding activity. Involved in cardiac muscle contraction; diaphragm contraction; and response to metal ion. Located in contractile fiber. Human ortholog(s) of this gene implicated in dilated cardiomyopathy 1Z; hypertrophic cardiomyopathy; and hypertrophic cardiomyopathy 13. Orthologous to human TNNC1 (troponin C1, slow skeletal and cardiac type); PARTICIPATES IN acebutolol pharmacodynamics pathway; adrenergic beta receptor agonist and beta-blocker pharmacodynamics pathway; amiodarone pharmacodynamics pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC290561; Tncc; troponin C type 1 (slow); troponin C, cardiac/slow skeletal; troponin C, slow skeletal and cardiac muscles

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	16	6,400,801 - 6,405,419 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	6,402,171 - 6,405,634 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	6,414,415 - 6,417,445 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	16	7,559,640 - 7,562,670 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	16	6,421,423 - 6,424,453 (+)	NCBI	Rnor_WKY
Rnor_6.0	16	7,292,207 - 7,295,238 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	7,292,096 - 7,295,465 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	7,220,777 - 7,223,730 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	6,639,357 - 6,642,331 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	6,639,312 - 6,642,502 (+)	NCBI
Celera	16	8,783,769 - 8,786,737 (-)	NCBI		Celera
Cytogenetic Map	16	p16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

cardiomyopathy (ISO)

congenital disorder of glycosylation In (ISO)

dilated cardiomyopathy (ISO)

dilated cardiomyopathy 1S (ISO)

dilated cardiomyopathy 1Z (ISO)

Dilated Cardiomyopathy with Left Ventricular Noncompaction (ISO)

genetic disease (ISO)

hypertrophic cardiomyopathy (ISO)

hypertrophic cardiomyopathy 13 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP)

4,4'-sulfonyldiphenol (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

amphetamine (EXP)

benzo[a]pyrene (ISO)

beta-naphthoflavone (EXP,ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

C60 fullerene (EXP)

calcium atom (ISO)

calcium(0) (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

choline (ISO)

cobalt atom (ISO)

cycloheximide (ISO)

dextran sulfate (ISO)

dibutyl phthalate (EXP,ISO)

dicrotophos (ISO)

dioxygen (ISO)

disodium selenite (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

Echimidine (EXP)

endosulfan (EXP)

entinostat (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fenvalerate (EXP)

folic acid (ISO)

gentamycin (EXP)

Heliotrine (EXP)

indole-3-methanol (EXP)

ivermectin (ISO)

L-methionine (ISO)

lithium chloride (ISO)

manganese(II) chloride (EXP)

methylmercury chloride (ISO)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

pirinixic acid (ISO)

progesterone (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

SB 431542 (ISO)

senecionine (EXP)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

succimer (ISO)

sulforaphane (ISO)

sunitinib (ISO)

tamoxifen (ISO)

tert-butyl hydroperoxide (ISO)

thalidomide (ISO)

titanium dioxide (ISO)

topotecan (EXP)

triclosan (ISO)

triptonide (ISO)

tris(2-butoxyethyl) phosphate (ISO)

trovafloxacin (ISO)

urethane (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cardiac muscle contraction (IBA,IMP,ISO)

diaphragm contraction (IDA)

regulation of ATP-dependent activity (ISO)

regulation of muscle contraction (ISO)

regulation of muscle filament sliding speed (ISO)

response to metal ion (IDA)

skeletal muscle contraction (IBA)

transition between fast and slow fiber (ISO)

ventricular cardiac muscle tissue morphogenesis (ISO)

Cellular Component

cardiac Troponin complex (IBA,ISO)

contractile fiber (IDA)

troponin complex (ISO)

Molecular Function

actin filament binding (ISO)

calcium ion binding (IBA,IDA,ISO)

calcium-dependent protein binding (IBA,ISO)

protein binding (ISO)

protein homodimerization activity (ISO)

troponin I binding (IBA,ISO)

troponin T binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

acebutolol pharmacodynamics pathway (ISO)

adrenergic beta receptor agonist and beta-blocker pharmacodynamics pathway (ISO)

amiodarone pharmacodynamics pathway (ISO)

amlodipine pharmacodynamics pathway (ISO)

atenolol pharmacodynamics pathway (ISO)

betaxolol pharmacodynamics pathway (ISO)

bisoprolol pharmacodynamics pathway (ISO)

bupranolol drug pathway (ISO)

bupranolol pharmacodynamics pathway (ISO)

calcium/calcium-mediated signaling pathway (IEA,ISO)

carvedilol pharmacodynamics pathway (ISO)

dilated cardiomyopathy pathway (IEA)

diltiazem pharmacodynamics pathway (ISO)

disopyramide pharmacodynamics pathway (ISO)

dobutamine pharmacodynamics pathway (ISO)

esmolol pharmacodynamics pathway (ISO)

flecainde pharmacodynamics pathway (ISO)

fosphenytoin pharmacodynamics pathway (ISO)

hypertrophic cardiomyopathy pathway (IEA)

ibutilide pharmacodynamics pathway (ISO)

isoprenaline pharmacodynamics pathway (ISO)

isradipine pharmacodynamics pathway (ISO)

levobunolol pharmacodynamics pathway (ISO)

lidocaine pharmacodynamics pathway (ISO)

metoprolol pharmacodynamics pathway (ISO)

mexiletine pharmacodynamics pathway (ISO)

nadolol pharmacodynamics pathway (ISO)

nebivolol pharmacodynamics pathway (ISO)

nifedipine pharmacodynamics pathway (ISO)

nimodipine pharmacodynamics pathway (ISO)

nisoldipine pharmacodynamics pathway (ISO)

nitrendipine pharmacodynamics pathway (ISO)

penbutolol pharmacodynamics pathway (ISO)

phenytoin pharmacodynamics pathway (ISO)

pindolol pharmacodynamics pathway (ISO)

procainamide pharmacodynamics pathway (ISO)

propranolol pharmacodynamics pathway (ISO)

quinidine pharmacodynamics pathway (ISO)

sotalol pharmacodynamics pathway (ISO)

timolol pharmacodynamics pathway (ISO)

verapamil pharmacodynamics pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Intrinsic cytosolic calcium buffering properties of single rat cardiac myocytes.	Berlin JR, etal., Biophys J. 1994 Oct;67(4):1775-87.
2.	Kinetic studies of calcium binding to the regulatory site of troponin C from cardiac muscle.	Dong W, etal., J Biol Chem. 1996 Jan 12;271(2):688-94.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	First mutation in cardiac troponin C, L29Q, in a patient with hypertrophic cardiomyopathy.	Hoffmann B, etal., Hum Mutat. 2001 Jun;17(6):524.
5.	Troponin C isoform composition determines differences in Sr(2+)-activation characteristics between rat diaphragm fibers.	O'Connell B, etal., Am J Physiol Cell Physiol. 2004 Jul;287(1):C79-87. Epub 2004 Feb 25.
6.	A single-fibre study of the relationship between MHC and TnC isoform composition in rat skeletal muscle.	O'Connell B, etal., Biochem J. 2004 Feb 15;378(Pt 1):269-74.
7.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Mechanism of action of endothelin in rat cardiac muscle: cross-bridge kinetics and myosin light chain phosphorylation.	Rossmanith GH, etal., J Physiol. 1997 Nov 15;505 ( Pt 1):217-27.
14.	Calcium, troponin, calmodulin, S100 proteins: from myocardial basics to new therapeutic strategies.	Schaub MC and Heizmann CW, Biochem Biophys Res Commun. 2008 Apr 25;369(1):247-64. Epub 2007 Oct 25.

Additional References at PubMed

PMID:7957210	PMID:8205619	PMID:8785301	PMID:10747195	PMID:10850966	PMID:11735257	PMID:12093807	PMID:12501194	PMID:12840750	PMID:15542288	PMID:17293397	PMID:18092822
PMID:18978355	PMID:20161772	PMID:21539814	PMID:22364878	PMID:22811351	PMID:23417789	PMID:23425245	PMID:23896515	PMID:25771144	PMID:26853943	PMID:26944554	PMID:28864299
PMID:29642034

Genomics

Comparative Map Data

Tnnc1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	16	6,400,801 - 6,405,419 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	6,402,171 - 6,405,634 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	6,414,415 - 6,417,445 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	16	7,559,640 - 7,562,670 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	16	6,421,423 - 6,424,453 (+)	NCBI	Rnor_WKY
Rnor_6.0	16	7,292,207 - 7,295,238 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	7,292,096 - 7,295,465 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	7,220,777 - 7,223,730 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	6,639,357 - 6,642,331 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	6,639,312 - 6,642,502 (+)	NCBI
Celera	16	8,783,769 - 8,786,737 (-)	NCBI		Celera
Cytogenetic Map	16	p16	NCBI

TNNC1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	52,451,100 - 52,454,041 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	3	52,451,100 - 52,454,041 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	52,485,116 - 52,488,057 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	52,460,158 - 52,463,098 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	52,460,157 - 52,463,098	NCBI
Celera	3	52,464,352 - 52,467,302 (-)	NCBI		Celera
Cytogenetic Map	3	p21.1	NCBI
HuRef	3	52,547,765 - 52,550,715 (-)	NCBI		HuRef
CHM1_1	3	52,437,484 - 52,440,434 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	52,484,001 - 52,486,942 (-)	NCBI		T2T-CHM13v2.0

Tnnc1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	30,930,274 - 30,933,671 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	30,930,269 - 30,933,686 (+)	Ensembl		GRCm39 Ensembl
GRCm38	14	31,208,312 - 31,211,729 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	31,208,312 - 31,211,729 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	32,021,498 - 32,024,897 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	30,037,321 - 30,040,720 (+)	NCBI		MGSCv36	mm8
Celera	14	27,466,935 - 27,470,320 (+)	NCBI		Celera
Cytogenetic Map	14	B	NCBI
cM Map	14	19.09	NCBI

Tnnc1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955430	2,434,874 - 2,441,596 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955430	2,438,644 - 2,441,596 (-)	NCBI	ChiLan1.0	ChiLan1.0

TNNC1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	3	52,450,941 - 52,453,930 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	52,393,106 - 52,396,076 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	53,621,749 - 53,624,726 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	53,621,749 - 53,624,726 (-)	Ensembl	panpan1.1		panPan2

TNNC1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	37,313,983 - 37,317,288 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	37,311,966 - 37,317,321 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	37,295,437 - 37,298,748 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	37,664,003 - 37,667,314 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	37,664,083 - 37,667,311 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	37,027,955 - 37,031,266 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	37,436,607 - 37,439,918 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	37,721,202 - 37,724,515 (+)	NCBI		UU_Cfam_GSD_1.0

Tnnc1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	170,152,389 - 170,155,387 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936473	3,290,913 - 3,294,132 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936473	3,290,961 - 3,293,920 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TNNC1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	34,591,386 - 34,594,337 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	34,591,571 - 34,594,320 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	37,805,313 - 37,808,062 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TNNC1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	13,816,603 - 13,819,572 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	13,816,222 - 13,819,518 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	153,080,316 - 153,083,290 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tnnc1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624822	4,764,742 - 4,770,293 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624822	4,763,285 - 4,767,810 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tnnc1
30 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	136
Count of miRNA genes:	92
Interacting mature miRNAs:	96
Transcripts:	ENSRNOT00000025606
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1357403	Slep4	Serum leptin concentration QTL 4	3.91		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	1	9639137	Rat
1600369	Hcas8	Hepatocarcinoma susceptibility QTL 8			liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	16	1	22477621	Rat
631830	Alc7	Alcohol consumption QTL 7	2.9		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	1	26727669	Rat
634355	Rends4	Renal damage susceptibility QTL 4		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	16	1	26727669	Rat
1582235	Insul8	Insulin level QTL 8	3.3	0.0063	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	16	1	26727669	Rat
9590151	Scort8	Serum corticosterone level QTL 8	8.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	16	1	30836262	Rat
2302380	Slep6	Serum leptin concentration QTL 6	3.36		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	1	32139025	Rat
2307172	Activ4	Activity QTL 4	3.71	0.00023	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	1	33418960	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39533930	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39533930	Rat
631561	Hcuc2	Hepatic copper content QTL 2	2.8		liver copper amount (VT:0003065)	liver total copper weight (CMO:0001507)	16	1	39533949	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	1	43534949	Rat
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	1	44588133	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	44977551	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	832236	46053497	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	832236	59492508	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	832236	59492508	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	832236	59492508	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	832236	59492508	Rat
2301406	Kidm39	Kidney mass QTL 39		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	16	2851709	15884239	Rat
1300133	Rf24	Renal function QTL 24	3.64		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	16	3380150	21361552	Rat
2306902	Bp339	Blood pressure QTL 339		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	3380150	43025077	Rat
737825	Alc13	Alcohol consumption QTL 13	4.5		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4227609	16039848	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	16	4227609	43025077	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4227609	43025077	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	4227609	43025077	Rat
737819	Hcas4	Hepatocarcinoma susceptibility QTL 4	4.43		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	16	4227609	46975965	Rat
61405	Niddm6	Non-insulin dependent diabetes mellitus QTL 6	3.66	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	16	4227609	48972724	Rat
61338	Bp23	Blood pressure QTL 23	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4227609	49227609	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4227609	60252231	Rat
61372	Bp40	Blood pressure QTL 40	2.2		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	16	4227730	17696785	Rat

Markers in Region

AI874626

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	6,404,988 - 6,405,105 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	7,294,987 - 7,295,103	NCBI	Rnor6.0
Rnor_5.0	16	7,223,479 - 7,223,595	UniSTS	Rnor5.0
RGSC_v3.4	16	6,642,080 - 6,642,196	UniSTS	RGSC3.4
Celera	16	8,783,905 - 8,784,021	UniSTS
Cytogenetic Map	16	p16	UniSTS

BI289970

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	6,401,676 - 6,401,835 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	7,291,675 - 7,291,833	NCBI	Rnor6.0
Rnor_5.0	16	7,220,245 - 7,220,403	UniSTS	Rnor5.0
RGSC_v3.4	16	6,638,825 - 6,638,983	UniSTS	RGSC3.4
Celera	16	8,787,111 - 8,787,269	UniSTS
RH 3.4 Map	16	49.0	UniSTS
Cytogenetic Map	16	p16	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High		43					1	1					1
Medium			11	9	2	9	7	9		35	34	8	7
Low	3		45	31	17	31		1	74		7	3
Below cutoff			1	1		1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001034105	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039094265	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039094266	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039094267	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC095672	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474046	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ062205	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217112	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224498	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224612	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224624	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000273	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000025606 ⟹ ENSRNOP00000025606

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	6,402,593 - 6,405,634 (+)	Ensembl
Rnor_6.0 Ensembl	16	7,292,096 - 7,295,465 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000094646 ⟹ ENSRNOP00000086929

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	6,402,171 - 6,405,413 (+)	Ensembl

RefSeq Acc Id:

NM_001034105 ⟹ NP_001029277

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	16	6,402,209 - 6,405,240 (+)	NCBI
Rnor_6.0	16	7,292,207 - 7,295,238 (+)	NCBI
Rnor_5.0	16	7,220,777 - 7,223,730 (+)	NCBI
RGSC_v3.4	16	6,639,357 - 6,642,331 (+)	RGD
Celera	16	8,783,769 - 8,786,737 (-)	RGD

Sequence:

show sequence

ATGGATGACATCTACAAAGCTGCGGTAGAGCAGTTGACAGAAGAACAGAAGAATGAGTTCAAGG
CTGCCTTCGATATCTTTGTCCTGGGCGCGGAGGATGGCTGCATCAGCACCAAGGAGCTGGGCAA
GGTGATGAGGATGCTGGGACAGAACCCCACACCTGAGGAGCTGCAGGAGATGATCGACGAGGTA
GACGAGGATGGCAGTGGCACAGTGGACTTCGACGAGTTCCTTGTCATGATGGTTCGGTGCATGA
AGGATGACAGCAAAGGGAAGTCTGAGGAGGAGCTGTCGGATCTCTTCCGCATGTTTGACAAAAA
CGCTGATGGCTACATTGACTTGGATGAACTGAAGATGATGCTGCAGGCCACAGGTGAGACCATC
ACGGAAGATGACATCGAAGAGCTCATGAAGGACGGTGACAAGAACAACGATGGCCGAATCGACT
ATGACGAGTTCCTGGAATTCATGAAGGGTGTGGAGTAG

hide sequence

RefSeq Acc Id:

XM_039094265 ⟹ XP_038950193

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	16	6,402,719 - 6,405,419 (+)	NCBI

RefSeq Acc Id:

XM_039094266 ⟹ XP_038950194

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	16	6,400,801 - 6,405,419 (+)	NCBI

RefSeq Acc Id:

XM_039094267 ⟹ XP_038950195

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	16	6,402,661 - 6,405,419 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001029277	(Get FASTA)	NCBI Sequence Viewer
	XP_038950193	(Get FASTA)	NCBI Sequence Viewer
	XP_038950194	(Get FASTA)	NCBI Sequence Viewer
	XP_038950195	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAY59902	(Get FASTA)	NCBI Sequence Viewer
	EDL88960	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001029277 ⟸ NM_001034105
- UniProtKB:	Q4PP99 (UniProtKB/TrEMBL), E9PTA1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEV DEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKMMLQATGETI TEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE hide sequence

RefSeq Acc Id:

ENSRNOP00000025606 ⟸ ENSRNOT00000025606

RefSeq Acc Id:	XP_038950194 ⟸ XM_039094266
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038950195 ⟸ XM_039094267
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038950193 ⟸ XM_039094265
- Peptide Label:	isoform X1
- UniProtKB:	A0A8J8XJV6 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000086929 ⟸ ENSRNOT00000094646

Protein Domains

EF-hand

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4PP99-F1-model_v2	AlphaFold	Q4PP99	1-161	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699928

Promoter ID:

EPDNEW_R10450

Type:

single initiation site

Name:

Tnnc1_1

Description:

troponin C1, slow skeletal and cardiac type

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	7,292,169 - 7,292,229	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309921	AgrOrtholog
BioCyc Gene	G2FUF-12157	BioCyc
Ensembl Genes	ENSRNOG00000018943	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000025606	ENTREZGENE
	ENSRNOP00000025606.6	UniProtKB/TrEMBL
	ENSRNOP00000086929	ENTREZGENE
	ENSRNOP00000086929.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000025606	ENTREZGENE
	ENSRNOT00000025606.7	UniProtKB/TrEMBL
	ENSRNOT00000094646	ENTREZGENE
	ENSRNOT00000094646.1	UniProtKB/TrEMBL
Gene3D-CATH	EF-hand	UniProtKB/TrEMBL
InterPro	EF-hand-like_dom	UniProtKB/TrEMBL
	EF_Hand_1_Ca_BS	UniProtKB/TrEMBL
	EF_hand_Ca-bd	UniProtKB/TrEMBL
KEGG Report	rno:290561	UniProtKB/TrEMBL
NCBI Gene	290561	ENTREZGENE
PANTHER	MYOSIN LIGHT CHAIN 1, 3	UniProtKB/TrEMBL
	MYOSIN LIGHT CHAIN 4	UniProtKB/TrEMBL
Pfam	EF-hand_8	UniProtKB/TrEMBL
	EF_hand_5	UniProtKB/TrEMBL
PhenoGen	Tnnc1	PhenoGen
PRINTS	RECOVERIN	UniProtKB/TrEMBL
PROSITE	EF_HAND_1	UniProtKB/TrEMBL
	EF_HAND_2	UniProtKB/TrEMBL
SMART	EFh	UniProtKB/TrEMBL
Superfamily-SCOP	SSF47473	UniProtKB/TrEMBL
UniProt	A0A8I6A4Q5_RAT	UniProtKB/TrEMBL
	A0A8J8XJV6	ENTREZGENE, UniProtKB/TrEMBL
	E9PTA1	ENTREZGENE
	Q4PP99	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	E9PTA1	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-24	Tnnc1	troponin C1, slow skeletal and cardiac type	Tnnc1	troponin C type 1 (slow)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-10-23	Tnnc1	troponin C type 1 (slow)	Tnnc1	troponin C, cardiac/slow skeletal	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Tnnc1	troponin C type 1 (slow)	Tncc	troponin C, cardiac/slow skeletal	Symbol and Name updated	1299863	APPROVED
2005-12-06	Tncc	troponin C, cardiac/slow skeletal	Tncc_predicted	troponin C, cardiac/slow skeletal (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Tncc_predicted	troponin C, cardiac/slow skeletal (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)