Pla2g2d (phospholipase A2, group IID)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Pla2g2d (phospholipase A2, group IID) Rattus norvegicus

Analyze

Symbol:

Pla2g2d

Name:

phospholipase A2, group IID

RGD ID:

1309862

Description:

Predicted to enable several functions, including calcium-dependent phospholipase A2 activity; heparan sulfate proteoglycan binding activity; and heparin binding activity. Predicted to be involved in glycerophospholipid metabolic process; negative regulation of T cell proliferation; and regulation of acute inflammatory response to antigenic stimulus. Predicted to act upstream of or within CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation and negative regulation of T cell activation. Predicted to be located in extracellular region. Orthologous to human PLA2G2D (phospholipase A2 group IID); PARTICIPATES IN glycerophospholipid metabolic pathway; alpha-linolenic acid metabolic pathway; arachidonic acid metabolic pathway; INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

group IID secretory phospholipase A2; LOC298579; MGC108956

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PLA2G2D (phospholipase A2 group IID)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pla2g2d (phospholipase A2, group IID)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pla2g2d (phospholipase A2 group IID)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PLA2G2D (phospholipase A2 group IID)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PLA2G2D (phospholipase A2 group IID)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pla2g2d (phospholipase A2 group IID)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PLA2G2D (phospholipase A2 group IID)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PLA2G2D (phospholipase A2 group IID)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pla2g2d (phospholipase A2 group IID)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PLA2G2D (phospholipase A2 group IID)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pla2g2d (phospholipase A2, group IID)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	151,016,010 - 151,022,531 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	151,018,870 - 151,022,525 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	153,714,211 - 153,720,401 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	155,488,513 - 155,494,703 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	155,469,996 - 155,476,182 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	157,222,636 - 157,228,795 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	157,222,636 - 157,228,791 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	160,962,324 - 160,970,156 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	157,594,706 - 157,600,865 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	157,604,744 - 157,610,900 (+)	NCBI
Celera	5	149,404,051 - 149,410,210 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

3-Hydroxy-3-Methylglutaryl-CoA Lyase Deficiency (ISO)

chromosome 1p36 deletion syndrome (ISO)

congenital disorder of glycosylation Ir (ISO)

genetic disease (ISO)

hyperprolinemia type 2 (ISO)

Parkinson's disease 6 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

aristolochic acids (EXP)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

crocidolite asbestos (ISO)

dimethylarsinic acid (ISO)

fenvalerate (EXP)

genistein (EXP)

gentamycin (EXP)

glycidol (EXP)

hydrogen peroxide (ISO)

irinotecan (EXP)

lead diacetate (ISO)

manganese(II) chloride (EXP)

methimazole (EXP)

methylarsonic acid (ISO)

N-methyl-4-phenylpyridinium (EXP)

ozone (ISO)

paclitaxel (EXP)

paracetamol (EXP,ISO)

paraquat (EXP)

resveratrol (ISO)

rotenone (EXP)

silicon dioxide (EXP)

sodium arsenate (ISO)

sodium arsenite (ISO)

tamoxifen (ISO)

testosterone (EXP)

tetracycline (ISO)

tetraphene (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

arachidonic acid secretion (IEA)

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation (ISO)

lipid catabolic process (IEA)

negative regulation of T cell activation (ISO)

negative regulation of T cell proliferation (IBA,ISO)

phosphatidylcholine metabolic process (ISO)

phosphatidylethanolamine metabolic process (ISO)

phosphatidylglycerol metabolic process (ISO)

phospholipid metabolic process (IBA)

regulation of acute inflammatory response to antigenic stimulus (ISO)

Cellular Component

extracellular region (ISO)

membrane (IEA)

Molecular Function

calcium ion binding (IBA)

calcium-dependent phospholipase A2 activity (IBA,ISO)

heparan sulfate proteoglycan binding (ISO)

heparin binding (ISO)

phospholipid binding (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

alpha-linolenic acid metabolic pathway (IEA)

arachidonic acid metabolic pathway (IEA)

ether lipid metabolic pathway (IEA)

Fc epsilon receptor mediated signaling pathway (IEA)

glutamate signaling pathway (IEA)

glycerophospholipid metabolic pathway (IEA,ISO)

gonadotropin-releasing hormone signaling pathway (IEA)

linoleic acid metabolic pathway (IEA)

long term depression (IEA)

mitogen activated protein kinase signaling pathway (IEA)

toxoplasmosis pathway (IEA)

vascular endothelial growth factor signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:10681567	PMID:19564598

Genomics

Comparative Map Data

Pla2g2d
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	151,016,010 - 151,022,531 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	151,018,870 - 151,022,525 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	153,714,211 - 153,720,401 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	155,488,513 - 155,494,703 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	155,469,996 - 155,476,182 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	157,222,636 - 157,228,795 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	157,222,636 - 157,228,791 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	160,962,324 - 160,970,156 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	157,594,706 - 157,600,865 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	157,604,744 - 157,610,900 (+)	NCBI
Celera	5	149,404,051 - 149,410,210 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

PLA2G2D
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	20,111,939 - 20,119,536 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	20,111,939 - 20,119,566 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	20,438,432 - 20,446,029 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	20,311,019 - 20,318,595 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	20,183,741 - 20,191,314	NCBI
Celera	1	18,761,553 - 18,769,129 (-)	NCBI		Celera
Cytogenetic Map	1	p36.12	NCBI
HuRef	1	18,684,974 - 18,691,890 (-)	NCBI		HuRef
CHM1_1	1	20,548,848 - 20,555,764 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	19,935,588 - 19,943,185 (-)	NCBI		T2T-CHM13v2.0

Pla2g2d
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	138,503,046 - 138,509,363 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	138,503,046 - 138,509,357 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	138,775,735 - 138,782,052 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	138,775,735 - 138,782,046 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	138,331,650 - 138,338,058 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	138,047,811 - 138,054,219 (+)	NCBI		MGSCv36	mm8
Celera	4	140,558,983 - 140,565,391 (+)	NCBI		Celera
Cytogenetic Map	4	D3	NCBI
cM Map	4	70.57	NCBI

Pla2g2d
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	736,600 - 743,806 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955452	738,133 - 743,718 (-)	NCBI	ChiLan1.0	ChiLan1.0

PLA2G2D
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	1	206,115,929 - 206,123,950 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	19,066,890 - 19,074,711 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	20,110,664 - 20,117,583 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	20,110,323 - 20,117,618 (-)	Ensembl	panpan1.1		panPan2

PLA2G2D
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	78,739,826 - 78,745,839 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	78,739,769 - 78,745,920 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	75,253,368 - 75,260,612 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	79,305,947 - 79,313,189 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	79,305,982 - 79,313,914 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	76,125,252 - 76,132,491 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	77,131,831 - 77,139,073 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	78,202,771 - 78,210,014 (+)	NCBI		UU_Cfam_GSD_1.0

Pla2g2d
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	40,342,725 - 40,347,968 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	6,167,507 - 6,172,750 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936474	6,167,507 - 6,172,750 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PLA2G2D
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	78,391,066 - 78,397,515 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	78,391,063 - 78,397,394 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	72,580,441 - 72,587,047 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PLA2G2D
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	112,434,208 - 112,441,215 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	112,434,276 - 112,441,249 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	3,743,003 - 3,750,801 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pla2g2d
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	5,224,018 - 5,229,609 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	5,224,071 - 5,229,603 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pla2g2d
22 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	161
Count of miRNA genes:	123
Interacting mature miRNAs:	136
Transcripts:	ENSRNOT00000022579
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	143069996	166846814	Rat
2302369	Scl60	Serum cholesterol level QTL 60	3.13		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	143608201	161165651	Rat
631263	Cm24	Cardiac mass QTL 24	3.5		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	143799107	158428037	Rat
1300119	Bp180	Blood pressure QTL 180	3.82		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	144358090	157869054	Rat
2313096	Bmd78	Bone mineral density QTL 78	3.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	5	144377876	161317411	Rat
1298090	Bp155	Blood pressure QTL 155	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	151006154	161165494	Rat

Markers in Region

D5Rat204

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	151,018,615 - 151,018,848 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	157,224,882 - 157,225,114	NCBI	Rnor6.0
Rnor_5.0	5	160,966,243 - 160,966,475	UniSTS	Rnor5.0
RGSC_v3.4	5	157,596,951 - 157,597,184	RGD	RGSC3.4
RGSC_v3.4	5	157,596,952 - 157,597,184	UniSTS	RGSC3.4
RGSC_v3.1	5	157,606,990 - 157,607,223	RGD
Celera	5	149,406,297 - 149,406,527	UniSTS
SHRSP x BN Map	5	89.8699	RGD
SHRSP x BN Map	5	89.8699	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2	1	9		19						6	11
Low	1	18	25	18		18	8	11	10	6	21		8
Below cutoff		12	19	19		19			35	11	3

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013428	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109678	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC118094	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079065	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC091221	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227390	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231588	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234103	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000022579 ⟹ ENSRNOP00000022579

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	151,018,870 - 151,022,525 (+)	Ensembl
Rnor_6.0 Ensembl	5	157,222,636 - 157,228,791 (+)	Ensembl

RefSeq Acc Id:

NM_001013428 ⟹ NP_001013446

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	151,016,345 - 151,022,529 (+)	NCBI
Rnor_6.0	5	157,222,636 - 157,228,795 (+)	NCBI
Rnor_5.0	5	160,962,324 - 160,970,156 (+)	NCBI
RGSC_v3.4	5	157,594,706 - 157,600,865 (+)	RGD
Celera	5	149,404,051 - 149,410,210 (+)	RGD

Sequence:

show sequence

CTGCCTTGCTCTGTGCTGGAACCATGAGACTTGCCCTGCTGTGTGGGCTGCTGCTGGCTGGTAT
AACTGCAACCCAGGGAGGGCTCCTGAACCTGAACAAGATGGTTAACCATATGACTGGGAAGAAA
GCCTTCTTCAGCTACTGGCCCTACGGCTGTCACTGTGGATTTGGTGGCAAAGGACAACCCAAGG
ATGCCACCGACTGGTGCTGTCAAAAGCACGATTGTTGCTATGCCCACCTGAAGATCGATGGATG
CAAAAGCCTGACAGACAATTACAAATACAGCATCTCTGAGGGCGTTATCCAATGCTCTGACCAA
GGGAGCTGGTGCGAAAGGCAACTGTGTGCTTGTGACAAGGAGGTGGCCTTGTGCCTGAAGCAAA
ACCTGGAGAGCTACAACAAGCGACTGCGGTACTACTGGAGGCCCCGCTGCAAAGGCCAGACTCC
CACATGCTAGGGGAATCCACTCTCTCTGTCCCCTGGATTCCACCCTGTTCCCGGGCATGTCAAG
CATTTAAGTCCTGCAGCTGCTGCCTCCTGCCTTGGTGTCTAGTCTCTTGGACCTGCTGGTTTTT
AAAGTCCTCCTTGCAAAAGAGCCTGGCCTTGATGATGTCCTCTTGGTGCCTCTCTGCTGTAAAG
GACCTTTCTGATCTTTCTATAAGTGACTCTCCTCTCCCTTCAAACTCTGGTCTTTCTGGGCCTA
GGATGAAATCTCTTTTATCTGTTCAGAGCCCAGCCCTCTGGCCCTGTGTCCTTCTCCTCAACTA
AGCTGTGAGACCCTCCTGGTTGAGCCCTGCCTCATCTCAGATTCAGTGGTACCCTGGTGTCCAG
GTAGTTTCCTAGAACCAAGCCCATTGTGGGCGCCAACAACAACAGGACTTACGGGTGGGGGAAA
CTGCAGCCTTGTTGCTATGGGTGCTAGAACTCGGCCTTCTGTTTCTTGTCTATTATGCTTTCTG
TTGGATCTCTTGTGGCATAAAGTTCAGGCCTGGGGCCCATCCTTTAGAAGCCTCTCTTGGCTAG
CGCTTCTCCCCAGCACTAAGGACATCATTGTGTTGGACTGTCTGGGTGGCCCAACACCCCACAA
TTCTTCTGAGACCAGGATACTGACATGTTCTAATACTTTGTCTCATTCCAGGCCTGGTTTCTTT
CTCTGCAAACTTTCTCCACAGAGTCCTCTCAATAAACAACTTTCACAAGAGTCCCTGACTCAGG
CTCCACCTCTGGGGAGACACATTGTAGCAACATTTATAAATTCTGTGACTTCCCTCTCTCCCAG
AACCAAGGGCCTAATTGCAAACCTCAGAAGTGATGCTACAGCTAAGGAAAGAGTGCTCAGGGGC
GGCAGATTCAGAGCCAGAATCCATGGAAGATCAGCTTCCCATATGAAGAAGGGGAGGGGAGGGT
TTGGGGGTGGCTTCGCTGGCTCTCTTTTTTGGCTCAAACTGACCCCGCCTACCTACATTCTTGC
AGCTATAGGCATTGAAGGGACTCTAGCCACCCTGGACCTGACAGACATGGCTGTAGCAGGCCGT
GCCCTTCTCTCTCATTCTTTCGGCCTTGCCTAAAACCACTAGACTGCATTTCTAAAGCTAGTTC
CCACAGTCTCTTCCCTTATTTAGCCAATTCCTTCCTCCTCCTGAGGCTGACTACCAAGGTCCAG
CTGTCAAAGTATTAAAGTCTAGCAATCAAAAGCCCGCTTTGGTTCACCTAATATGCCCAGTCAA
AACACACCATTGCCCCCAGCCCATTCTAACACAGACCTCCCCCCTTCCCCCTTCTTATGAATTA
TGCCTGCAAGGTCCTTTGCTGATGTTTTTCTGTCTGAGTCAGAAAGCAGCCACTTCAACTTTTC
TTCCCTGCTTAATAAAAGATCTTTCTGTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039109678 ⟹ XP_038965606

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	151,016,010 - 151,022,531 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001013446	(Get FASTA)	NCBI Sequence Viewer
	XP_038965606	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91221	(Get FASTA)	NCBI Sequence Viewer
	EDL80887	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001013446 ⟸ NM_001013428
- Peptide Label:	precursor
- UniProtKB:	Q5BK35 (UniProtKB/TrEMBL), F7F420 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRLALLCGLLLAGITATQGGLLNLNKMVNHMTGKKAFFSYWPYGCHCGFGGKGQPKDATDWCCQ KHDCCYAHLKIDGCKSLTDNYKYSISEGVIQCSDQGSWCERQLCACDKEVALCLKQNLESYNKR LRYYWRPRCKGQTPTC hide sequence

RefSeq Acc Id:

ENSRNOP00000022579 ⟸ ENSRNOT00000022579

RefSeq Acc Id:	XP_038965606 ⟸ XM_039109678
- Peptide Label:	isoform X1

Protein Domains

Phospholipase A2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5BK35-F1-model_v2	AlphaFold	Q5BK35	1-144	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309862	AgrOrtholog
BioCyc Gene	G2FUF-39441	BioCyc
Ensembl Genes	ENSRNOG00000016826	Ensembl, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000022579.5	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000022579.6	UniProtKB/TrEMBL
Gene3D-CATH	1.20.90.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7121340	IMAGE-MGC_LOAD
	IMAGE:7125035	IMAGE-MGC_LOAD
InterPro	Phospholipase_A2	UniProtKB/TrEMBL
	Phospholipase_A2_euk	UniProtKB/TrEMBL
	PLipase_A2_Asp_AS	UniProtKB/TrEMBL
	PLipase_A2_dom_sf	UniProtKB/TrEMBL
	PLipase_A2_His_AS	UniProtKB/TrEMBL
KEGG Report	rno:298579	UniProtKB/TrEMBL
MGC_CLONE	MGC:108956	IMAGE-MGC_LOAD
	MGC:94015	IMAGE-MGC_LOAD
NCBI Gene	298579	ENTREZGENE
PANTHER	GROUP IID SECRETORY PHOSPHOLIPASE A2	UniProtKB/TrEMBL
	Phospholipase_A2	UniProtKB/TrEMBL
Pfam	Phospholip_A2_1	UniProtKB/TrEMBL
PhenoGen	Pla2g2d	PhenoGen
PRINTS	PHPHLIPASEA2	UniProtKB/TrEMBL
PROSITE	PA2_ASP	UniProtKB/TrEMBL
	PA2_HIS	UniProtKB/TrEMBL
SMART	PA2c	UniProtKB/TrEMBL
Superfamily-SCOP	PhospholipaseA2	UniProtKB/TrEMBL
UniProt	A6ITI6_RAT	UniProtKB/TrEMBL
	F7F420	ENTREZGENE, UniProtKB/TrEMBL
	Q5BK35	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Pla2g2d	phospholipase A2, group IID	Pla2g2d_predicted	phospholipase A2, group IID (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Pla2g2d_predicted	phospholipase A2, group IID (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)