Pdcl3 (phosducin-like 3) - Rat Genome Database

Advanced Search (OLGA)

Gene: Pdcl3 (phosducin-like 3) Rattus norvegicus

Analyze

Symbol:

Pdcl3

Name:

phosducin-like 3

RGD ID:

1309663

Description:

Enables protein folding chaperone. Involved in cellular response to heat and protein folding. Predicted to be located in cytosol; endoplasmic reticulum; and nuclear lumen. Predicted to be part of protein-containing complex. Predicted to be active in cytoplasm. Orthologous to human PDCL3 (phosducin like 3); INTERACTS WITH 2,6-dinitrotoluene; 2-methoxyethanol; 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC316348; MGC116329; phosducin-like protein 3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PDCL3 (phosducin like 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pdcl3 (phosducin-like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pdcl3 (phosducin like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PDCL3 (phosducin like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PDCL3 (phosducin like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pdcl3 (phosducin like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PDCL3 (phosducin like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PDCL3 (phosducin like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pdcl3 (phosducin like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PDCL3 (phosducin like 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pdcl3 (phosducin-like 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pdcl3 (phosducin-like 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PLP2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	viaf	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pdcl3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	48,730,083 - 48,738,554 (+)	NCBI		GRCr8
mRatBN7.2	9	41,234,322 - 41,243,769 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	41,234,234 - 41,243,735 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	49,728,486 - 49,736,952 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	54,851,230 - 54,859,696 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	53,135,081 - 53,143,552 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	45,672,257 - 45,680,728 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	45,672,157 - 45,680,799 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	45,362,541 - 45,371,012 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	38,004,222 - 38,012,693 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	38,005,635 - 38,014,107 (+)	NCBI
Celera	9	38,984,793 - 38,993,264 (+)	NCBI		Celera
Cytogenetic Map	9	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,6-dinitrotoluene (EXP)

2-methoxyethanol (EXP)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

all-trans-retinoic acid (EXP,ISO)

amiodarone (EXP)

arsenous acid (ISO)

atrazine (ISO)

benzatropine (ISO)

benzbromarone (EXP)

benzene (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

C60 fullerene (EXP)

cannabidiol (ISO)

cisplatin (ISO)

clobetasol (ISO)

clofibrate (EXP)

cobalt dichloride (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

ivermectin (ISO)

L-ethionine (EXP)

lead(0) (ISO)

methylmercury(1+) (EXP)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

omeprazole (EXP)

paracetamol (EXP)

PCB138 (EXP)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenethyl isothiocyanate (ISO)

phenobarbital (EXP)

pirinixic acid (EXP)

progesterone (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

Soman (EXP)

thapsigargin (EXP)

thioacetamide (EXP)

trichloroethene (EXP)

triptonide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin cytoskeleton organization (IEA,ISO)

angiogenesis (IBA,IEA,ISO)

apoptotic process (IEA)

cellular response to heat (IDA)

chaperone-mediated protein folding (IEA,ISO)

negative regulation of chaperone-mediated protein folding (IEA,ISO)

negative regulation of ubiquitin-dependent protein catabolic process (IEA,ISO)

positive regulation of angiogenesis (IEA,ISO)

positive regulation of endothelial cell proliferation (IEA,ISO)

positive regulation of gene expression (IBA,IEA,ISO)

protein folding (IBA,IDA)

protein stabilization (IEA,ISO)

regulation of peptidyl-tyrosine phosphorylation (IEA,ISO)

Cellular Component

cytoplasm (IBA,ISO)

cytosol (IEA,ISO)

endoplasmic reticulum (IEA,ISO)

nucleoplasm (IEA,ISO)

perinuclear region of cytoplasm (IEA)

perinucleolar compartment (IEA,ISO)

protein-containing complex (IEA,ISO)

Molecular Function

protein binding (IPI,ISO)

protein folding chaperone (IBA,IDA,IEA,ISO)

vascular endothelial growth factor receptor 2 binding (IBA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Interaction of a Novel Chaperone PhLP2A With the Heat Shock Protein Hsp90.	Krzemień-Ojak Ł, etal., J Cell Biochem. 2017 Feb;118(2):420-429. doi: 10.1002/jcb.25669. Epub 2016 Oct 17.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15371430	PMID:15489334	PMID:17429077	PMID:23792958	PMID:26059764

Genomics

Comparative Map Data

Pdcl3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	48,730,083 - 48,738,554 (+)	NCBI		GRCr8
mRatBN7.2	9	41,234,322 - 41,243,769 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	41,234,234 - 41,243,735 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	49,728,486 - 49,736,952 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	54,851,230 - 54,859,696 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	53,135,081 - 53,143,552 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	45,672,257 - 45,680,728 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	45,672,157 - 45,680,799 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	45,362,541 - 45,371,012 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	38,004,222 - 38,012,693 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	38,005,635 - 38,014,107 (+)	NCBI
Celera	9	38,984,793 - 38,993,264 (+)	NCBI		Celera
Cytogenetic Map	9	q22	NCBI

PDCL3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	100,562,993 - 100,576,739 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	100,562,993 - 100,576,739 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	101,179,455 - 101,193,201 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	100,545,859 - 100,559,633 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	100,637,944 - 100,651,719	NCBI
Celera	2	95,384,039 - 95,397,821 (+)	NCBI		Celera
Cytogenetic Map	2	q11.2	NCBI
HuRef	2	94,943,898 - 94,957,677 (+)	NCBI		HuRef
CHM1_1	2	101,183,727 - 101,197,486 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	101,021,740 - 101,035,465 (+)	NCBI		T2T-CHM13v2.0

Pdcl3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	39,026,895 - 39,036,317 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	39,024,689 - 39,036,319 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	38,987,814 - 38,997,236 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	38,985,608 - 38,997,238 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	39,044,659 - 39,054,081 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	38,932,360 - 38,941,782 (+)	NCBI		MGSCv36	mm8
Celera	1	38,777,037 - 38,786,281 (+)	NCBI		Celera
Cytogenetic Map	1	B	NCBI
cM Map	1	17.36	NCBI

Pdcl3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955470	6,553,450 - 6,563,814 (+)	NCBI	ChiLan1.0	ChiLan1.0

PDCL3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	27,650,776 - 27,663,784 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	27,653,533 - 27,666,151 (-)	NCBI		NHGRI_mPanPan1
PanPan1.1	2A	101,538,872 - 101,551,669 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

PDCL3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	42,214,127 - 42,223,986 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	42,215,120 - 42,223,906 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	42,137,411 - 42,147,413 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	43,080,268 - 43,090,236 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	43,079,573 - 43,090,129 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	42,791,342 - 42,801,288 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	43,075,653 - 43,085,591 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	43,266,979 - 43,276,929 (-)	NCBI		UU_Cfam_GSD_1.0

Pdcl3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	86,141,438 - 86,150,373 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936661	419,113 - 428,032 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PDCL3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	53,674,509 - 53,692,928 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	53,681,798 - 53,693,034 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	56,244,971 - 56,256,183 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PDCL3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	4,275,182 - 4,289,041 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666041	171,892,827 - 171,907,083 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pdcl3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624749	5,410,476 - 5,422,533 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624749	5,410,501 - 5,419,625 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pdcl3
40 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	247
Count of miRNA genes:	167
Interacting mature miRNAs:	193
Transcripts:	ENSRNOT00000017882
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411571	Bw138	Body weight QTL 138	14.3	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	9	32535505	77535505	Rat
1300180	Bw14	Body weight QTL 14	3.776		body mass (VT:0001259)	body weight (CMO:0000012)	9	23754024	61381613	Rat
631680	Cm11	Cardiac mass QTL 11	3.1	0.00089	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	9	20430519	65430519	Rat
70218	Cm28	Cardiac mass QTL 28	8.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	25268044	79271759	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	25268044	114175309	Rat
1354650	Despr5	Despair related QTL 5	4.01	0.0017	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	9	1254084	46254084	Rat
7207805	Bmd88	Bone mineral density QTL 88	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	9	23754024	58157242	Rat
631643	Bp120	Blood pressure QTL 120	3	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	22071200	67071200	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	25661188	100929786	Rat
9589133	Insul26	Insulin level QTL 26	17.96	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	9	8952560	53952560	Rat
631211	Bw4	Body weight QTL4	5.31		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	9	5109826	50109826	Rat
2303559	Gluco54	Glucose level QTL 54	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	1254084	46254084	Rat
7411609	Foco16	Food consumption QTL 16	25.6	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	8952560	53952560	Rat
8662828	Vetf6	Vascular elastic tissue fragility QTL 6	3.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	9	36962359	92058970	Rat
1598834	Memor11	Memory QTL 11	2.5		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	9	36962359	77814038	Rat
70186	Niddm26	Non-insulin dependent diabetes mellitus QTL 26	3.87		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	9	22071169	86369743	Rat
7207814	Bmd91	Bone mineral density QTL 91	3.5		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	9	23754144	83851531	Rat
6903941	Pur31	Proteinuria QTL 31		0.036	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	9	40194188	85194188	Rat
1641911	Alcrsp13	Alcohol response QTL 13			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	1	43718459	Rat
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	36962359	95410867	Rat
11353949	Bp393	Blood pressure QTL 393			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	40194188	85194188	Rat
61425	Cia15	Collagen induced arthritis QTL 15	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	9	5109826	42921101	Rat
10054125	Srcrt7	Stress Responsive Cort QTL 7	3.33	0.0011	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	9	1	87073594	Rat
1600365	Mcs20	Mammary carcinoma susceptibility QTL 20	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	9	13533770	42791750	Rat
11353947	Bp392	Blood pressure QTL 392			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	7283252	52283252	Rat
1331757	Cdexp1	CD45RC expression in CD8 T cells QTL 1	4.3		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	9	1024537	67509080	Rat
7411656	Foco26	Food consumption QTL 26	9.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	32535505	77535505	Rat
1298088	Edpm11	Estrogen-dependent pituitary mass QTL 11	2.5		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	1	43718459	Rat
1598823	Memor16	Memory QTL 16	1.9		exploratory behavior trait (VT:0010471)	difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678)	9	22133322	49968732	Rat
1641894	Alcrsp12	Alcohol response QTL 12			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	27468639	72468639	Rat

Markers in Region

RH128453

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	41,241,884 - 41,242,103 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	45,679,820 - 45,680,038	NCBI	Rnor6.0
Rnor_5.0	9	45,370,104 - 45,370,322	UniSTS	Rnor5.0
RGSC_v3.4	9	38,011,785 - 38,012,003	UniSTS	RGSC3.4
Celera	9	38,992,356 - 38,992,574	UniSTS
RH 3.4 Map	9	382.2	UniSTS
Cytogenetic Map	9	q21	UniSTS

RH133234

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	41,242,385 - 41,242,588 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	45,680,321 - 45,680,523	NCBI	Rnor6.0
Rnor_5.0	9	45,370,605 - 45,370,807	UniSTS	Rnor5.0
RGSC_v3.4	9	38,012,286 - 38,012,488	UniSTS	RGSC3.4
Celera	9	38,992,857 - 38,993,059	UniSTS
Cytogenetic Map	9	q21	UniSTS

RH141636

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	41,243,453 - 41,243,672 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	45,681,389 - 45,681,607	NCBI	Rnor6.0
Rnor_5.0	9	45,371,673 - 45,371,891	UniSTS	Rnor5.0
RGSC_v3.4	9	38,013,354 - 38,013,572	UniSTS	RGSC3.4
Celera	9	38,993,925 - 38,994,143	UniSTS
RH 3.4 Map	9	380.99	UniSTS
Cytogenetic Map	9	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025709	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC099162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473965	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211568	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229403	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000017882 ⟹ ENSRNOP00000017882

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	41,234,234 - 41,243,735 (+)	Ensembl
Rnor_6.0 Ensembl	9	45,672,157 - 45,680,799 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102761 ⟹ ENSRNOP00000096257

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	41,237,153 - 41,243,689 (+)	Ensembl

RefSeq Acc Id:

NM_001025709 ⟹ NP_001020880

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	48,730,083 - 48,738,554 (+)	NCBI
mRatBN7.2	9	41,234,322 - 41,242,793 (+)	NCBI
Rnor_6.0	9	45,672,257 - 45,680,728 (+)	NCBI
Rnor_5.0	9	45,362,541 - 45,371,012 (+)	NCBI
RGSC_v3.4	9	38,004,222 - 38,012,693 (+)	RGD
Celera	9	38,984,793 - 38,993,264 (+)	RGD

Sequence:

show sequence

CCGAAGGGGCGGTGCTACAAGGCGCCAGAGGAGCGGAGGCTGGGGCCTAGGGGCTGGTCGGAAC
TTCTGGAAGCAAGATGCAGGACCCCAACGCAGACACCGAGTGGAATGACATCCTTCGTAAAAAG
GGCATCCTTCCCCCTAAGGAGAGCCTGAAGGAGCTGGAGGAGGAGGAGGAGGGAAAGGAGGAGC
AGCGTCTCCAGCAGTCAGTGGTGAAGACATATGAAGACATGACCCTGGAGGAGCTGCAGGAGAA
CGAAGACGAGTTCAGTGAGGAGGACGAGCGAGCCATCGAGATGTACCGGCAGCAAAGGCTGGCC
GAGTGGAAGGCGACTCAGCTGAGGAACAAGTTTGGAGAAGTTTTAGAGATCTCGGGGAAGGATT
ACGTTCAAGAAGTCACCAAGGCTGGCGAGGGCTTGTGGGTGGTCTTACACCTGTACAAACAAGG
GATTCCCCTCTGTTCCTTGATAAACCATCACTTGAGTGGGCTCGCCAGGAAGTTTCCCGATGTG
AAATTTATCAAAGCCATTTCAACGACCTGCATACCCAATTACCCTGACAGGAACCTCCCCACAG
TGTTCGTCTACCGGGAGGGGGATATCAAGGCACAGTTCATCGGTCCCCTGGTGTTCGGTGGCAT
GAACCTGACCATAGATGAGTTGGAGTGGAAACTATCTGAGTCAGGAGCAATCAAGACAGAGCTG
GAGGAGAACCCCAAGAAAGCCATCAAAGACGTGCTGCTGTCCTCAGTGCGGGACCCTGTCCCCA
TGAGGAGGGACAGTGATTCCGAGGACGACTAAGATAGCAGTGATGCAGCCTTTCGAACTCTCTT
GATAAGACGCATTGTCTGGAGTTTCAATAAGGAGGGAAAAGCAATAATTTATCCTTTTGGGTTT
TAACCTTTTTATAATTATTTAAATTTTATACATTTCAGATATAATCATTGCTGAAATTTTTTAA
GAAATTTGTTGGAACTCTTTATAATGTTTCTTTAAGAATTTAAGCTCTTATGTCACATATCCAT
GTTTTCCTACATGTGTTTCAGCAAACCCTGTGACTGTTTAGTATCTTTTGACATGCAACTATAG
AGAAAGGAATGTGGAGTTTAAAAACACAATGCAAATAAATTAAGTTAAAAACTAAAACATAACA
GTGCAGAAAACAAGAACTCGGCTTTATAGTTAAGTCAGACTGTCCATTTTCATTTTATAAAGCT
AGCAAAAGAAATATCAGCTGATAGAAATGGCTGATAATTTTGAGACAAATACTGTCTTATCAAA
CTAGCTGACAGATTTCAGCTTACACCATGTTTGTATTCAGGTCAGTCTTCCAGTTAACTCACGT
GTGTCTCTGGCTGTTAAGACACCAGCTGTTCTTTGTGGTGGCACATGCTTTTAATCCCAGCACT
GGGACACAGGCAGGCAGGTCATGTGAGTTCAAGGCTGGTCTGGCTTGCAGGGCCAGGGCCACCT
CACCAAGACCCTGTCTTGAAGCCAAAAACAGAGCTGTTCTTGGCTCTAAGGTCCTGTTAGGTTC
GGCTTGGGGGACTGAGGTTTAAGCACACACACATGTAAGCTGTGTCCCAGCTGATTTATAAAAA
TGTTTCGGGATACTCTTTGAGTCAGAATCCTATAAATTGATGATGAAAGCTGAAAAGTATCAAT
AATATTTTTGTTGAATGTGGTAACATGTATAGCTGATTGGAACCTTAGAGATAAGAGTCTAAGA
ATACAGGATTTGTTCAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001020880	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH99162	(Get FASTA)	NCBI Sequence Viewer
	EDL99204	(Get FASTA)	NCBI Sequence Viewer
	EDL99205	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000017882.5
	ENSRNOP00000096257.1
GenBank Protein	Q4KLJ8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001020880 ⟸ NM_001025709

- UniProtKB:

Q4KLJ8 (UniProtKB/Swiss-Prot), A6INK5 (UniProtKB/TrEMBL), A0A8I6AQA2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MQDPNADTEWNDILRKKGILPPKESLKELEEEEEGKEEQRLQQSVVKTYEDMTLEELQENEDEF
SEEDERAIEMYRQQRLAEWKATQLRNKFGEVLEISGKDYVQEVTKAGEGLWVVLHLYKQGIPLC
SLINHHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTVFVYREGDIKAQFIGPLVFGGMNLTI
DELEWKLSESGAIKTELEENPKKAIKDVLLSSVRDPVPMRRDSDSEDD

hide sequence

Ensembl Acc Id:

ENSRNOP00000017882 ⟸ ENSRNOT00000017882

Ensembl Acc Id:

ENSRNOP00000096257 ⟸ ENSRNOT00000102761

Protein Domains

Phosducin thioredoxin-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4KLJ8-F1-model_v2	AlphaFold	Q4KLJ8	1-240	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696623

Promoter ID:

EPDNEW_R7147

Type:

initiation region

Name:

Pdcl3_1

Description:

phosducin-like 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	45,672,265 - 45,672,325	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309663	AgrOrtholog
BioCyc Gene	G2FUF-27759	BioCyc
Ensembl Genes	ENSRNOG00000013286	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000017882.7	UniProtKB/TrEMBL
	ENSRNOT00000102761.1	UniProtKB/TrEMBL
Gene3D-CATH	Glutaredoxin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7381935	IMAGE-MGC_LOAD
InterPro	Phosducin-like_chap/apop_reg	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Phosducin_thioredoxin-like_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Thioredoxin-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:316348	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:116329	IMAGE-MGC_LOAD
NCBI Gene	316348	ENTREZGENE
PANTHER	PHOSDUCIN-LIKE PROTEIN 3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	VIRAL IAP-ASSOCIATED FACTOR HOMOLOG	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Phosducin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Pdcl3	PhenoGen
RatGTEx	ENSRNOG00000013286	RatGTEx
Superfamily-SCOP	SSF52833	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6AQA2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2Q950_RAT	UniProtKB/TrEMBL
	A6INK5	ENTREZGENE, UniProtKB/TrEMBL
	A6INK6_RAT	UniProtKB/TrEMBL
	PDCL3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Pdcl3	phosducin-like 3	Pdcl3_predicted	phosducin-like 3 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Pdcl3_predicted	phosducin-like 3 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message