Cisd1 (CDGSH iron sulfur domain 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Cisd1 (CDGSH iron sulfur domain 1) Rattus norvegicus

Analyze

Symbol:

Cisd1

Name:

CDGSH iron sulfur domain 1

RGD ID:

1309529

Description:

Predicted to enable several functions, including 2 iron, 2 sulfur cluster binding activity; L-cysteine transaminase activity; and protein homodimerization activity. Predicted to be involved in protein maturation by [2Fe-2S] cluster transfer. Predicted to act upstream of or within regulation of cellular respiration. Located in cytoplasmic side of mitochondrial outer membrane. Orthologous to human CISD1 (CDGSH iron sulfur domain 1); INTERACTS WITH 2,2,2-tetramine; 2,3,7,8-tetrachlorodibenzodioxine; 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CDGSH iron sulfur domain-containing protein 1; CDGSH iron-sulfur domain-containing protein 1; cysteine transaminase CISD1; LOC294362; MitoNEET; RGD1309529; similar to DNA segment, Chr 10, ERATO Doi 214, expressed

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CISD1 (CDGSH iron sulfur domain 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cisd1 (CDGSH iron sulfur domain 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cisd1 (CDGSH iron sulfur domain 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CISD1 (CDGSH iron sulfur domain 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CISD1 (CDGSH iron sulfur domain 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cisd1 (CDGSH iron sulfur domain 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LOC100520401 (CDGSH iron-sulfur domain-containing protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CISD1 (CDGSH iron sulfur domain 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cisd1 (CDGSH iron sulfur domain 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CISD1 (CDGSH iron sulfur domain 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cisd1 (CDGSH iron sulfur domain 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cisd1 (CDGSH iron sulfur domain 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Cisd2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	cisd-1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	17,255,302 - 17,268,688 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	17,255,151 - 17,284,924 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	17,982,017 - 17,995,396 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	20	17,337,013 - 17,350,392 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	20	17,809,669 - 17,823,049 (+)	NCBI	Rnor_WKY
Rnor_6.0	20	18,493,538 - 18,506,923 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	18,493,538 - 18,506,912 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	20,659,781 - 20,673,162 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	17,985,985 - 17,999,366 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	17,999,708 - 18,013,170 (+)	NCBI
Celera	20	18,654,774 - 18,668,172 (+)	NCBI		Celera
Cytogenetic Map	20	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17beta-estradiol (ISO)

2,2,2-tetramine (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-methylcholine (ISO)

3-methylcholanthrene (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

4-hydroxyphenyl retinamide (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

amiodarone (EXP)

atrazine (ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

carbon nanotube (ISO)

chloropicrin (ISO)

clobetasol (ISO)

clofibrate (EXP)

cocaine (EXP)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

deguelin (ISO)

dibutyl phthalate (EXP,ISO)

dicrotophos (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

ethyl methanesulfonate (ISO)

folic acid (ISO)

formaldehyde (ISO)

gold atom (ISO)

gold(0) (ISO)

ivermectin (ISO)

L-ethionine (EXP)

methyl methanesulfonate (ISO)

methylparaben (ISO)

nickel sulfate (ISO)

omeprazole (EXP)

paracetamol (EXP,ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

picoxystrobin (ISO)

pirinixic acid (EXP,ISO)

potassium chromate (ISO)

propiconazole (ISO)

Propiverine (EXP)

rotenone (EXP,ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

streptozocin (EXP)

tetrachloromethane (ISO)

thioacetamide (EXP)

tolcapone (EXP)

trimellitic anhydride (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

protein maturation by [2Fe-2S] cluster transfer (ISO,ISS)

regulation of autophagy (IEA)

regulation of cellular respiration (ISO)

Cellular Component

cytoplasmic side of mitochondrial outer membrane (IDA)

endoplasmic reticulum membrane (IEA)

mitochondrial outer membrane (IBA,IEA,ISO)

mitochondrion (ISO)

Molecular Function

2 iron, 2 sulfur cluster binding (IBA,IEA,ISO,ISS)

identical protein binding (ISO)

L-cysteine transaminase activity (ISO,ISS)

metal ion binding (IEA)

protein homodimerization activity (ISO,ISS)

pyridoxal phosphate binding (ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	MitoNEET is an iron-containing outer mitochondrial membrane protein that regulates oxidative capacity.	Wiley SE, etal., Proc Natl Acad Sci U S A. 2007 Mar 27;104(13):5318-23. Epub 2007 Mar 21.

Additional References at PubMed

PMID:12477932	PMID:14570702	PMID:14651853	PMID:15489334	PMID:17766439	PMID:17766440	PMID:18614015	PMID:19348892	PMID:20833797	PMID:23376485	PMID:27748416	PMID:29476059
PMID:33723216

Genomics

Comparative Map Data

Cisd1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	17,255,302 - 17,268,688 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	17,255,151 - 17,284,924 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	17,982,017 - 17,995,396 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	20	17,337,013 - 17,350,392 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	20	17,809,669 - 17,823,049 (+)	NCBI	Rnor_WKY
Rnor_6.0	20	18,493,538 - 18,506,923 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	18,493,538 - 18,506,912 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	20,659,781 - 20,673,162 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	17,985,985 - 17,999,366 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	17,999,708 - 18,013,170 (+)	NCBI
Celera	20	18,654,774 - 18,668,172 (+)	NCBI		Celera
Cytogenetic Map	20	p11	NCBI

CISD1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	58,269,162 - 58,289,586 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	10	58,269,162 - 58,289,586 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	60,028,922 - 60,049,346 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	59,698,921 - 59,717,868 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	59,698,920 - 59,717,867	NCBI
Celera	10	53,293,811 - 53,313,947 (+)	NCBI		Celera
Cytogenetic Map	10	q21.1	NCBI
HuRef	10	54,017,734 - 54,037,889 (+)	NCBI		HuRef
CHM1_1	10	60,310,639 - 60,330,794 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	59,123,271 - 59,143,693 (+)	NCBI		T2T-CHM13v2.0

Cisd1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	71,166,324 - 71,180,679 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	71,166,310 - 71,180,784 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	71,330,494 - 71,344,849 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	71,330,480 - 71,344,954 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	70,793,242 - 70,807,597 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	70,725,794 - 70,740,149 (-)	NCBI		MGSCv36	mm8
Celera	10	72,405,693 - 72,420,047 (-)	NCBI		Celera
Cytogenetic Map	10	B5.3	NCBI
cM Map	10	36.88	NCBI

Cisd1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955425	12,009,702 - 12,020,956 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955425	12,009,704 - 12,020,956 (+)	NCBI	ChiLan1.0	ChiLan1.0

CISD1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	10	57,020,351 - 57,041,928 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	57,020,351 - 57,041,928 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	10	54,800,423 - 54,822,134 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

CISD1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	4	10,654,205 - 10,672,015 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	10,717,948 - 10,735,572 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	4	10,702,717 - 10,719,998 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	10,822,037 - 10,839,524 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	11,131,497 - 11,149,126 (+)	NCBI		UU_Cfam_GSD_1.0

Cisd1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	70,617,791 - 70,637,540 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936614	4,706,463 - 4,723,756 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LOC100520401
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	11	66,967,238 - 66,967,696 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	11	74,078,934 - 74,079,275 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CISD1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	73,011,461 - 73,029,998 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	73,011,797 - 73,030,266 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	33,913,149 - 33,932,988 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cisd1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624791	5,307,376 - 5,324,368 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624791	5,306,777 - 5,325,250 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cisd1
36 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	233
Count of miRNA genes:	163
Interacting mature miRNAs:	190
Transcripts:	ENSRNOT00000000749
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	2892597	26381954	Rat
4889857	Pur27	Proteinuria QTL 27	12.2	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	4606607	17617956	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	4606607	17617956	Rat
70154	Insul2	Insulin level QTL 2	3.75		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	6691706	17489458	Rat
1581577	Pur15	Proteinuria QTL 15	4.38	0.0002	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	20	8042410	17617956	Rat
4889870	Pur30	Proteinuria QTL 30	19	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	8042410	29322208	Rat
7411652	Foco24	Food consumption QTL 24		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	11757515	54435887	Rat
9590092	Insglur9	Insulin/glucose ratio QTL 9	18.38	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	20	11757515	54435887	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106385	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017601618	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC132039	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC159419	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211256	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000324	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000000749 ⟹ ENSRNOP00000000749

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	17,255,151 - 17,284,924 (+)	Ensembl
Rnor_6.0 Ensembl	20	18,493,538 - 18,506,912 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000103790 ⟹ ENSRNOP00000085759

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	17,255,288 - 17,267,849 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000105985 ⟹ ENSRNOP00000087939

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	17,260,252 - 17,284,924 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000119535 ⟹ ENSRNOP00000086958

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	17,259,789 - 17,268,459 (+)	Ensembl

RefSeq Acc Id:

NM_001106385 ⟹ NP_001099855

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	20	17,255,302 - 17,268,688 (+)	NCBI
Rnor_6.0	20	18,493,538 - 18,506,919 (+)	NCBI
Rnor_5.0	20	20,659,781 - 20,673,162 (+)	NCBI
RGSC_v3.4	20	17,985,985 - 17,999,366 (+)	RGD
Celera	20	18,654,774 - 18,668,172 (+)	RGD

Sequence:

show sequence

CCCGAGGTCGCGTCTTTCCCCCAGGTCTCCGCGGTCCCCAGCGCTCGCCCGCGCGGTCCTGCCA
CGGCCTTCCTGCTGCCCGCGCCATGGGCCTCAGCTCCGACTCCCCTGTGCGAGTTGAGTGGATC
GCCGCCGTGACCTTTGCTGCTGGCACAGCCGCTCTCGGTTACCTGGCTTACAAGAAGTTCTACG
CTAAAGAGAGTCGCACCAAAGCTATGGTGAACCTTCAGATCCAGAAAGACAACCCGAAGGTTGT
GCACGCCTTCGACATGGAGGATCTGGGGGATAAGGCCGTGTATTGCCGGTGCTGGAGGTCTAAA
AAGTTCCCGTTCTGCGATGGGGCTCACATAAAGCACAATGAGGAGACTGGAGACAACGTGGGAC
CTCTGATCATCAAGAAAAAAGAAACTTAATGGACAGTTGCGAGGCTACACCCCAGCGTGTTGTG
ATGTCACCTGATCATTTAATTAGAATGGCACCCAACCCACTGTCTGGTTGGCCTCCCAGGTTCT
GGTGTGGTTGGTACTTGCAAATCGCAGCTTTCATGTTCACGGCATCGGCCTTGCCATTGAAACA
TCGTGGTGCACATTTGTTGAAAGAAGAAGAAAAGGAAAGGCTGAACCAACCTCATGCTCTGTGG
GTTATCTTGGTCTCGTAAGGATCCGTTCCTTTAAAATAATGGTCTTAGAATAGAGTTATGTCTT
GAGGTTATATATTAAATTATTCCAAAATCAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099855	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI59420	(Get FASTA)	NCBI Sequence Viewer
	B0K020	(Get FASTA)	NCBI Sequence Viewer
	EDL97255	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001099855 ⟸ NM_001106385
- UniProtKB:	B0K020 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MGLSSDSPVRVEWIAAVTFAAGTAALGYLAYKKFYAKESRTKAMVNLQIQKDNPKVVHAFDMED LGDKAVYCRCWRSKKFPFCDGAHIKHNEETGDNVGPLIIKKKET hide sequence

RefSeq Acc Id:

ENSRNOP00000000749 ⟸ ENSRNOT00000000749

RefSeq Acc Id:

ENSRNOP00000087939 ⟸ ENSRNOT00000105985

RefSeq Acc Id:

ENSRNOP00000085759 ⟸ ENSRNOT00000103790

RefSeq Acc Id:

ENSRNOP00000086958 ⟸ ENSRNOT00000119535

Protein Domains

Iron-binding zinc finger CDGSH type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B0K020-F1-model_v2	AlphaFold	B0K020	1-108	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701552

Promoter ID:

EPDNEW_R12076

Type:

initiation region

Name:

Cisd1_1

Description:

CDGSH iron sulfur domain 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	20	18,493,519 - 18,493,579	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309529	AgrOrtholog
BioCyc Gene	G2FUF-4048	BioCyc
Ensembl Genes	ENSRNOG00000000610	Ensembl, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000000749.5	UniProtKB/TrEMBL
	ENSRNOP00000085759.1	UniProtKB/TrEMBL
	ENSRNOP00000086958.1	UniProtKB/TrEMBL
	ENSRNOP00000087939.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000000749.7	UniProtKB/TrEMBL
	ENSRNOT00000103790.1	UniProtKB/TrEMBL
	ENSRNOT00000105985.1	UniProtKB/TrEMBL
	ENSRNOT00000119535.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.5.90	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:8370407	IMAGE-MGC_LOAD
InterPro	CISD1/2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FeS-contain_CDGSH-typ	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FeS-contain_mitoNEET_C	UniProtKB/Swiss-Prot
	FeS-contain_mitoNEET_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	MitoNEET_CISD	UniProtKB/TrEMBL
KEGG Report	rno:294362	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:188705	IMAGE-MGC_LOAD
NCBI Gene	294362	ENTREZGENE
PANTHER	CDGSH IRON-SULFUR DOMAIN-CONTAINING PROTEIN 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR13680	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	MitoNEET_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	zf-CDGSH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Cisd1	PhenoGen
SMART	ZnF_CDGSH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6A322_RAT	UniProtKB/TrEMBL
	A0A8I6A430_RAT	UniProtKB/TrEMBL
	A0A8I6GFI7_RAT	UniProtKB/TrEMBL
	A0A8L2PYH4_RAT	UniProtKB/TrEMBL
	B0K020	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-26	Cisd1	CDGSH iron sulfur domain 1	RGD1309529_predicted	similar to DNA segment, Chr 10, ERATO Doi 214, expressed (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	RGD1309529_predicted	similar to DNA segment, Chr 10, ERATO Doi 214, expressed (predicted)	LOC294362_predicted		Symbol and Name status set to approved	1331353	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar