Advanced Search (OLGA)

Gene: Ndufs3 (NADH:ubiquinone oxidoreductase core subunit S3) Rattus norvegicus

Analyze

Symbol:

Ndufs3

Name:

NADH:ubiquinone oxidoreductase core subunit S3

RGD ID:

1309406

Description:

Predicted to enable NADH dehydrogenase activity. Predicted to contribute to NADH dehydrogenase (ubiquinone) activity. Predicted to be involved in several processes, including mitochondrial electron transport, NADH to ubiquinone; mitochondrial respiratory chain complex I assembly; and substantia nigra development. Predicted to be located in mitochondrial membrane and nuclear body. Predicted to be part of respiratory chain complex I. Predicted to be active in mitochondrial inner membrane. Biomarker of Parkinsonism. Human ortholog(s) of this gene implicated in nuclear type mitochondrial complex I deficiency 8. Orthologous to human NDUFS3 (NADH:ubiquinone oxidoreductase core subunit S3); PARTICIPATES IN doxorubicin pharmacokinetics pathway; Alzheimer's disease pathway; Huntington's disease pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC295923; NADH dehydrogenase (ubiquinone) Fe-S protein 3; NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	97,332,477 - 97,339,654 (-)	NCBI		GRCr8
mRatBN7.2	3	76,876,646 - 76,883,824 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	76,876,646 - 76,883,824 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	80,354,354 - 80,361,560 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	88,952,835 - 88,960,041 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	86,804,226 - 86,811,400 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	79,721,686 - 79,728,863 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	79,721,694 - 79,728,879 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	86,430,806 - 86,437,983 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	75,256,383 - 75,263,560 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	75,152,762 - 75,159,826 (-)	NCBI
Celera	3	76,085,667 - 76,092,843 (-)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ndufs3	Rat	Alzheimer's disease	onset	ISO	RGD:1319736	13824970		RGD
Ndufs3	Rat	Cardiomegaly		IEP		7800726		RGD
Ndufs3	Rat	Diabetic Nephropathies		IEP		8552684	associated with Diabetes Mellitus, Experimental;mRNA:increased expression:kidney,glomerulus	RGD
Ndufs3	Rat	Diabetic Nephropathies	treatment	IEP		13792578	associated with Diabetes Mellitus, Experimental	RGD
Ndufs3	Rat	Experimental Diabetes Mellitus		IEP		6484699	protein:decreased expression:dorsal root ganglia (rat)	RGD
Ndufs3	Rat	Experimental Diabetes Mellitus		IEP		13824971	mRNA, protein:decreased expression:brain	RGD
Ndufs3	Rat	Parkinsonism		IEP		13824972		RGD

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ndufs3	Rat	congenital disorder of glycosylation type IIc		ISO	RGD:1319736	8554872	ClinVar Annotator: match by term: Rambam Hasharon syndrome	ClinVar	PMID:16455955\|PMID:24403049\|PMID:28492532
Ndufs3	Rat	genetic disease		ISO	RGD:1319736	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:25741868\|PMID:28492532
Ndufs3	Rat	intellectual disability		ISO	RGD:1319736	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar
Ndufs3	Rat	Leigh disease		ISO	RGD:1319736	8554872	ClinVar Annotator: match by term: Leigh syndrome \| ClinVar Annotator: match by term: Leigh's disease more ...	ClinVar	PMID:17576681\|PMID:25741868\|PMID:28492532\|PMID:33097395\|PMID:9536098
Ndufs3	Rat	mitochondrial complex I deficiency		ISO	RGD:1319736	8554872	ClinVar Annotator: match by term: MITOCHONDRIAL NADH DEHYDROGENASE COMPONENT OF COMPLEX I, DEFICIENCY OF \| more ...	ClinVar	PMID:17576681\|PMID:25741868\|PMID:28492532\|PMID:33097395\|PMID:9536098
Ndufs3	Rat	nuclear type mitochondrial complex I deficiency 1		ISO	RGD:1319736	8554872	ClinVar Annotator: match by term: Mitochondrial complex I deficiency, nuclear type 1	ClinVar	PMID:17576681\|PMID:25741868\|PMID:28492532\|PMID:33097395\|PMID:9536098
Ndufs3	Rat	nuclear type mitochondrial complex I deficiency 8		ISO	RGD:1319736	8554872	ClinVar Annotator: match by term: MITOCHONDRIAL COMPLEX I DEFICIENCY, NUCLEAR TYPE 8 \| ClinVar Annotator: more ...	ClinVar	PMID:14729820\|PMID:17576681\|PMID:22499348\|PMID:25741868\|PMID:28492532\|PMID:30140060\|PMID:33097395\|PMID:9536098
Ndufs3	Rat	Subacute Necrotizing Encephalopathy of Leigh, Infantile		ISO	RGD:1319736	8554872	ClinVar Annotator: match by term: Leigh's necrotizing encephalopathy	ClinVar	PMID:17576681\|PMID:25741868\|PMID:28492532\|PMID:33097395\|PMID:9536098

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ndufs3	Rat	Breast Neoplasms		ISO	RGD:1319736	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:21466612
Ndufs3	Rat	Chemical and Drug Induced Liver Injury		ISO	RGD:1319736	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:25231249
Ndufs3	Rat	Leigh disease		ISO	RGD:1319736	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:14729820
Ndufs3	Rat	optic atrophy		ISO	RGD:1319736	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:14729820

Imported Disease Annotations - OMIM

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ndufs3	Rat	nuclear type mitochondrial complex I deficiency 8		ISO	RGD:1319736	7240710		OMIM

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ndufs3	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	RGD:1319737	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NDUFS3 mRNA	CTD	PMID:17942748
Ndufs3	Rat	17beta-estradiol	multiple interactions	ISO	RGD:1319736	6480464	Estradiol promotes the reaction [NDUFS3 protein binds to ESR1 protein]	CTD	PMID:27156127
Ndufs3	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1319737	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NDUFS3 mRNA	CTD	PMID:17942748
Ndufs3	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of NDUFS3 mRNA	CTD	PMID:33387578
Ndufs3	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1319736	6480464	Tetrachlorodibenzodioxin results in decreased expression of NDUFS3 mRNA	CTD	PMID:23152189
Ndufs3	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1319736	6480464	2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of NDUFS3 mRNA]; alpha-naphthoflavone more ...	CTD	PMID:23152189
Ndufs3	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1319737	6480464	Tetrachlorodibenzodioxin affects the expression of NDUFS3 mRNA	CTD	PMID:21570461
Ndufs3	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of NDUFS3 mRNA	CTD	PMID:21215274
Ndufs3	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1319737	6480464	Tetrachlorodibenzodioxin results in increased expression of NDUFS3 mRNA	CTD	PMID:20399798
Ndufs3	Rat	2,6-dimethoxyphenol	multiple interactions	ISO	RGD:1319736	6480464	[Furaldehyde co-treated with pyrogallol 1,3-dimethyl ether] results in increased expression of NDUFS3 protein; [Sodium Chloride more ...	CTD	PMID:38598786
Ndufs3	Rat	3-methyladenine	multiple interactions	ISO	RGD:1319736	6480464	3-methyladenine inhibits the reaction [Chlorpyrifos results in decreased expression of NDUFS3 protein]	CTD	PMID:26070385
Ndufs3	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1319737	6480464	bisphenol S results in increased expression of NDUFS3 mRNA	CTD	PMID:39298647
Ndufs3	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1319736	6480464	bisphenol S results in increased expression of NDUFS3 protein	CTD	PMID:34186270
Ndufs3	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Ndufs3	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of NDUFS3 mRNA	CTD	PMID:30047161
Ndufs3	Rat	acetamide	decreases expression	EXP		6480464	acetamide results in decreased expression of NDUFS3 mRNA	CTD	PMID:31881176
Ndufs3	Rat	aflatoxin B1	increases methylation	ISO	RGD:1319736	6480464	Aflatoxin B1 results in increased methylation of NDUFS3 gene	CTD	PMID:27153756
Ndufs3	Rat	all-trans-retinoic acid	multiple interactions	ISO	RGD:1319736	6480464	[IFNB1 protein co-treated with Tretinoin] results in increased expression of NDUFS3 mRNA; [IFNB1 protein co-treated more ...	CTD	PMID:16826196
Ndufs3	Rat	alpha-naphthoflavone	multiple interactions	ISO	RGD:1319736	6480464	alpha-naphthoflavone inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of NDUFS3 mRNA]	CTD	PMID:23152189
Ndufs3	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of NDUFS3 mRNA	CTD	PMID:30047161
Ndufs3	Rat	arsane	increases expression	ISO	RGD:1319736	6480464	Arsenic results in increased expression of NDUFS3 protein	CTD	PMID:21514422
Ndufs3	Rat	arsane	multiple interactions	ISO	RGD:1319736	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of NDUFS3 more ...	CTD	PMID:39836092
Ndufs3	Rat	arsane	decreases expression	ISO	RGD:1319736	6480464	Arsenic results in decreased expression of NDUFS3 protein	CTD	PMID:25110733
Ndufs3	Rat	arsenic atom	increases expression	ISO	RGD:1319736	6480464	Arsenic results in increased expression of NDUFS3 protein	CTD	PMID:21514422
Ndufs3	Rat	arsenic atom	multiple interactions	ISO	RGD:1319736	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of NDUFS3 more ...	CTD	PMID:39836092
Ndufs3	Rat	arsenic atom	decreases expression	ISO	RGD:1319736	6480464	Arsenic results in decreased expression of NDUFS3 protein	CTD	PMID:25110733
Ndufs3	Rat	atrazine	decreases expression	ISO	RGD:1319736	6480464	Atrazine results in decreased expression of NDUFS3 mRNA	CTD	PMID:22378314
Ndufs3	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	RGD:1319737	6480464	Diethylhexyl Phthalate results in decreased expression of NDUFS3 mRNA	CTD	PMID:35550907
Ndufs3	Rat	bisphenol A	increases expression	ISO	RGD:1319736	6480464	bisphenol A results in increased expression of NDUFS3 mRNA; bisphenol A results in increased expression more ...	CTD	PMID:25047013\|PMID:37567409
Ndufs3	Rat	bisphenol A	decreases expression	ISO	RGD:1319736	6480464	bisphenol A results in decreased expression of NDUFS3 protein	CTD	PMID:34186270
Ndufs3	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Ndufs3	Rat	bisphenol A	increases expression	ISO	RGD:1319737	6480464	bisphenol A results in increased expression of NDUFS3 mRNA	CTD	PMID:33221593
Ndufs3	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of NDUFS3 mRNA	CTD	PMID:25181051
Ndufs3	Rat	bisphenol AF	increases expression	ISO	RGD:1319736	6480464	bisphenol AF results in increased expression of NDUFS3 protein	CTD	PMID:34186270
Ndufs3	Rat	Bisphenol B	increases expression	ISO	RGD:1319736	6480464	bisphenol B results in increased expression of NDUFS3 protein	CTD	PMID:34186270
Ndufs3	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Ndufs3	Rat	Brodifacoum	increases expression	EXP		6480464	bromfenacoum results in increased expression of NDUFS3 protein	CTD	PMID:28903499
Ndufs3	Rat	cadmium atom	multiple interactions	ISO	RGD:1319737	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of NDUFS3 more ...	CTD	PMID:33038468
Ndufs3	Rat	cadmium dichloride	multiple interactions	ISO	RGD:1319737	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of NDUFS3 more ...	CTD	PMID:33038468
Ndufs3	Rat	CGP 52608	multiple interactions	ISO	RGD:1319736	6480464	CGP 52608 promotes the reaction [RORA protein binds to NDUFS3 gene]	CTD	PMID:28238834
Ndufs3	Rat	chloropicrin	increases expression	ISO	RGD:1319736	6480464	chloropicrin results in increased expression of NDUFS3 mRNA	CTD	PMID:26352163
Ndufs3	Rat	chlorpromazine	decreases expression	EXP		6480464	Chlorpromazine results in decreased expression of NDUFS3 protein	CTD	PMID:19441803
Ndufs3	Rat	chlorpyrifos	multiple interactions	ISO	RGD:1319736	6480464	3-methyladenine inhibits the reaction [Chlorpyrifos results in decreased expression of NDUFS3 protein]; PRKN protein inhibits more ...	CTD	PMID:26070385
Ndufs3	Rat	chlorpyrifos	decreases expression	ISO	RGD:1319736	6480464	Chlorpyrifos results in decreased expression of NDUFS3 protein	CTD	PMID:26070385
Ndufs3	Rat	chromium(6+)	decreases expression	ISO	RGD:1319736	6480464	chromium hexavalent ion results in decreased expression of NDUFS3 protein	CTD	PMID:22886373
Ndufs3	Rat	cisplatin	increases expression	ISO	RGD:1319736	6480464	Cisplatin results in increased expression of NDUFS3 mRNA	CTD	PMID:27392435
Ndufs3	Rat	clofibrate	increases expression	EXP		6480464	Clofibrate results in increased expression of NDUFS3 protein	CTD	PMID:16470657
Ndufs3	Rat	clofibric acid	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of NDUFS3 mRNA	CTD	PMID:17602206
Ndufs3	Rat	clotrimazole	increases expression	EXP		6480464	Clotrimazole results in increased expression of NDUFS3 mRNA	CTD	PMID:30047161
Ndufs3	Rat	copper atom	increases expression	ISO	RGD:1319737	6480464	Copper analog results in increased expression of NDUFS3 protein	CTD	PMID:23882024
Ndufs3	Rat	copper atom	decreases expression	EXP		6480464	Copper results in decreased expression of NDUFS3 mRNA	CTD	PMID:22465980
Ndufs3	Rat	copper(0)	increases expression	ISO	RGD:1319737	6480464	Copper analog results in increased expression of NDUFS3 protein	CTD	PMID:23882024
Ndufs3	Rat	copper(0)	decreases expression	EXP		6480464	Copper results in decreased expression of NDUFS3 mRNA	CTD	PMID:22465980
Ndufs3	Rat	copper(II) sulfate	decreases expression	ISO	RGD:1319736	6480464	Copper Sulfate results in decreased expression of NDUFS3 mRNA	CTD	PMID:19549813
Ndufs3	Rat	corosolic acid	decreases expression	ISO	RGD:1319736	6480464	corosolic acid results in decreased expression of NDUFS3 mRNA	CTD	PMID:37939859
Ndufs3	Rat	cyclosporin A	decreases expression	ISO	RGD:1319736	6480464	Cyclosporine results in decreased expression of NDUFS3 mRNA	CTD	PMID:20106945\|PMID:27989131
Ndufs3	Rat	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of NDUFS3 mRNA	CTD	PMID:21266533
Ndufs3	Rat	dichloromethane	multiple interactions	ISO	RGD:1319737	6480464	[propylene dichloride co-treated with Methylene Chloride] results in decreased expression of NDUFS3 protein	CTD	PMID:30240022
Ndufs3	Rat	dichloromethane	affects expression	ISO	RGD:1319737	6480464	Methylene Chloride affects the expression of NDUFS3 protein	CTD	PMID:30240022
Ndufs3	Rat	disodium selenite	increases expression	ISO	RGD:1319736	6480464	Sodium Selenite results in increased expression of NDUFS3 mRNA	CTD	PMID:18175754
Ndufs3	Rat	doxorubicin	affects expression	ISO	RGD:1319737	6480464	Doxorubicin affects the expression of NDUFS3 mRNA	CTD	PMID:26873546
Ndufs3	Rat	elemental selenium	increases expression	ISO	RGD:1319736	6480464	Selenium results in increased expression of NDUFS3 mRNA	CTD	PMID:19244175
Ndufs3	Rat	flutamide	decreases expression	ISO	RGD:1319737	6480464	Flutamide results in decreased expression of NDUFS3 mRNA	CTD	PMID:19442681
Ndufs3	Rat	furfural	multiple interactions	ISO	RGD:1319736	6480464	[Furaldehyde co-treated with pyrogallol 1,3-dimethyl ether] results in increased expression of NDUFS3 protein; [Sodium Chloride more ...	CTD	PMID:38598786
Ndufs3	Rat	genistein	increases expression	ISO	RGD:1319737	6480464	Genistein results in increased expression of NDUFS3 mRNA	CTD	PMID:32186404
Ndufs3	Rat	isoniazide	affects expression	ISO	RGD:1319737	6480464	Isoniazid affects the expression of NDUFS3 mRNA	CTD	PMID:24848797
Ndufs3	Rat	isoprenaline	multiple interactions	EXP		6480464	[Isoproterenol co-treated with POSTN protein] results in decreased expression of NDUFS3 mRNA	CTD	PMID:30303030
Ndufs3	Rat	isotretinoin	decreases expression	ISO	RGD:1319736	6480464	Isotretinoin results in decreased expression of NDUFS3 mRNA	CTD	PMID:20436886
Ndufs3	Rat	ivermectin	decreases expression	ISO	RGD:1319736	6480464	Ivermectin results in decreased expression of NDUFS3 protein	CTD	PMID:32959892
Ndufs3	Rat	L-methionine	decreases expression	EXP		6480464	Methionine deficiency results in decreased expression of NDUFS3 protein	CTD	PMID:17716000
Ndufs3	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1319736	6480464	[Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of NDUFS3 mRNA	CTD	PMID:31059760
Ndufs3	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of NDUFS3 mRNA	CTD	PMID:30047161
Ndufs3	Rat	N-methyl-4-phenylpyridinium	decreases expression	ISO	RGD:1319736	6480464	1-Methyl-4-phenylpyridinium results in decreased expression of NDUFS3 protein	CTD	PMID:24675778\|PMID:24806433
Ndufs3	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of NDUFS3 mRNA	CTD	PMID:17602206
Ndufs3	Rat	niclosamide	decreases expression	ISO	RGD:1319736	6480464	Niclosamide results in decreased expression of NDUFS3 mRNA	CTD	PMID:22576131
Ndufs3	Rat	nitrates	multiple interactions	ISO	RGD:1319737	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of NDUFS3 more ...	CTD	PMID:35964746
Ndufs3	Rat	paracetamol	affects expression	ISO	RGD:1319737	6480464	Acetaminophen affects the expression of NDUFS3 mRNA	CTD	PMID:17562736
Ndufs3	Rat	paracetamol	decreases expression	ISO	RGD:1319736	6480464	Acetaminophen results in decreased expression of NDUFS3 mRNA	CTD	PMID:29067470\|PMID:31059760
Ndufs3	Rat	paracetamol	multiple interactions	ISO	RGD:1319736	6480464	[Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of NDUFS3 mRNA	CTD	PMID:31059760
Ndufs3	Rat	paraquat	decreases expression	ISO	RGD:1319736	6480464	Paraquat results in decreased expression of NDUFS3 protein	CTD	PMID:34064677
Ndufs3	Rat	pyrroloquinoline quinone	multiple interactions	EXP		6480464	PQQ Cofactor inhibits the reaction [Rotenone results in decreased expression of NDUFS3 mRNA]	CTD	PMID:26276080
Ndufs3	Rat	quercetin	decreases expression	ISO	RGD:1319736	6480464	Quercetin results in decreased expression of NDUFS3 protein	CTD	PMID:15748282
Ndufs3	Rat	rac-1,2-dichloropropane	multiple interactions	ISO	RGD:1319737	6480464	[propylene dichloride co-treated with Methylene Chloride] results in decreased expression of NDUFS3 protein	CTD	PMID:30240022
Ndufs3	Rat	rac-1,2-dichloropropane	decreases expression	ISO	RGD:1319737	6480464	propylene dichloride results in decreased expression of NDUFS3 protein	CTD	PMID:30240022
Ndufs3	Rat	resveratrol	increases expression	ISO	RGD:1319737	6480464	resveratrol results in increased expression of NDUFS3 mRNA	CTD	PMID:22610192
Ndufs3	Rat	resveratrol	multiple interactions	ISO	RGD:1319736	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of NDUFS3 mRNA	CTD	PMID:23557933
Ndufs3	Rat	resveratrol	increases expression	ISO	RGD:1319736	6480464	resveratrol results in increased expression of NDUFS3 protein	CTD	PMID:24365713
Ndufs3	Rat	rotenone	decreases expression	ISO	RGD:1319737	6480464	Rotenone results in decreased expression of NDUFS3 mRNA	CTD	PMID:23186747
Ndufs3	Rat	rotenone	multiple interactions	ISO	RGD:1319736	6480464	PARK7 protein inhibits the reaction [Rotenone results in decreased expression of NDUFS3 protein]	CTD	PMID:29649621
Ndufs3	Rat	rotenone	decreases expression	EXP		6480464	Rotenone results in decreased expression of NDUFS3 mRNA; Rotenone results in decreased expression of NDUFS3 more ...	CTD	PMID:26276080\|PMID:29649621
Ndufs3	Rat	rotenone	multiple interactions	EXP		6480464	PQQ Cofactor inhibits the reaction [Rotenone results in decreased expression of NDUFS3 mRNA]	CTD	PMID:26276080
Ndufs3	Rat	selenium atom	increases expression	ISO	RGD:1319736	6480464	Selenium results in increased expression of NDUFS3 mRNA	CTD	PMID:19244175
Ndufs3	Rat	sodium arsenite	decreases expression	ISO	RGD:1319736	6480464	sodium arsenite results in decreased expression of NDUFS3 mRNA	CTD	PMID:38568856
Ndufs3	Rat	sodium arsenite	multiple interactions	ISO	RGD:1319736	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of NDUFS3 more ...	CTD	PMID:33939924\|PMID:39836092
Ndufs3	Rat	sodium arsenite	increases expression	ISO	RGD:1319736	6480464	sodium arsenite results in increased expression of NDUFS3 mRNA	CTD	PMID:34032870
Ndufs3	Rat	sodium chloride	multiple interactions	ISO	RGD:1319736	6480464	[Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of more ...	CTD	PMID:38598786
Ndufs3	Rat	T-2 toxin	affects expression	EXP		6480464	T-2 Toxin affects the expression of NDUFS3 protein	CTD	PMID:26141394
Ndufs3	Rat	T-2 toxin	multiple interactions	EXP		6480464	GABPA promotes the reaction [T-2 Toxin results in increased expression of NDUFS3 mRNA]; T-2 Toxin more ...	CTD	PMID:36863559
Ndufs3	Rat	T-2 toxin	increases expression	EXP		6480464	T-2 Toxin results in increased expression of NDUFS3 mRNA	CTD	PMID:26141394\|PMID:29870751\|PMID:36863559
Ndufs3	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of NDUFS3 mRNA	CTD	PMID:34492290
Ndufs3	Rat	thiram	decreases expression	ISO	RGD:1319736	6480464	Thiram results in decreased expression of NDUFS3 mRNA	CTD	PMID:38568856
Ndufs3	Rat	titanium dioxide	decreases methylation	ISO	RGD:1319737	6480464	titanium dioxide results in decreased methylation of NDUFS3 gene	CTD	PMID:35295148
Ndufs3	Rat	toluene	affects expression	EXP		6480464	Toluene affects the expression of NDUFS3 mRNA	CTD	PMID:21827849
Ndufs3	Rat	valproic acid	decreases methylation	ISO	RGD:1319736	6480464	Valproic Acid results in decreased methylation of NDUFS3 gene	CTD	PMID:29154799
Ndufs3	Rat	valproic acid	affects expression	ISO	RGD:1319736	6480464	Valproic Acid affects the expression of NDUFS3 mRNA	CTD	PMID:25979313
Ndufs3	Rat	vitamin E	increases expression	ISO	RGD:1319736	6480464	Vitamin E results in increased expression of NDUFS3 mRNA	CTD	PMID:19244175

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ndufs3	Rat	biological_process		ND		1598407	11/2018: no relevant rat data	RGD
Ndufs3	Rat	mitochondrial electron transport, NADH to ubiquinone	involved_in	ISO	RGD:1319736	1624291	PMID:14729820, PMID:30140060	RGD	PMID:14729820\|PMID:30140060
Ndufs3	Rat	mitochondrial electron transport, NADH to ubiquinone	involved_in	ISO	RGD:1319737	1624291	PMID:31916679, PMID:33148885	RGD	PMID:31916679\|PMID:33148885
Ndufs3	Rat	mitochondrial electron transport, NADH to ubiquinone	involved_in	IEA	UniProtKB:O75489\|ensembl:ENSP00000263774	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ndufs3	Rat	mitochondrial respiratory chain complex I assembly	involved_in	ISO	RGD:1319736	1624291	PMID:30140060	RGD	PMID:30140060
Ndufs3	Rat	mitochondrial respiratory chain complex I assembly	involved_in	ISO	RGD:1319737	1624291	PMID:31916679, PMID:33148885	RGD	PMID:31916679\|PMID:33148885
Ndufs3	Rat	mitochondrial respiratory chain complex I assembly	involved_in	IEA	UniProtKB:O75489\|ensembl:ENSP00000263774	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ndufs3	Rat	proton transmembrane transport	involved_in	IEA	GO:0008137	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Ndufs3	Rat	reactive oxygen species metabolic process	involved_in	ISO	RGD:1319736	1624291	PMID:16826196	RGD	PMID:16826196
Ndufs3	Rat	reactive oxygen species metabolic process	involved_in	IEA	UniProtKB:O75489\|ensembl:ENSP00000263774	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ndufs3	Rat	substantia nigra development	involved_in	ISO	RGD:1319736	9068941	PMID:22926577	UniProt	PMID:22926577

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ndufs3	Rat	mitochondrial inner membrane	is_active_in	ISO	RGD:1319737	1624291	PMID:38575788	RGD	PMID:38575788
Ndufs3	Rat	mitochondrial inner membrane	located_in	ISO	RGD:1319736	1624291	PMID:18826940, PMID:28844695	RGD	PMID:18826940\|PMID:28844695
Ndufs3	Rat	mitochondrial inner membrane	located_in	IEA	UniProtKB:O75489\|ensembl:ENSP00000263774	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ndufs3	Rat	mitochondrial membrane	located_in	ISO	RGD:1319736	1624291	PMID:17209039	RGD	PMID:17209039
Ndufs3	Rat	mitochondrial membrane	located_in	IEA	UniProtKB:O75489\|ensembl:ENSP00000263774	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ndufs3	Rat	mitochondrion	located_in	IEA	UniProtKB:O75489\|ensembl:ENSP00000263774	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ndufs3	Rat	mitochondrion	located_in	ISO	RGD:1319737	1624291	PMID:19837698	RGD	PMID:19837698
Ndufs3	Rat	mitochondrion	located_in	ISO	RGD:1319736\|UniProtKB:O75489-1	1624291		RGD	GO_REF:0000052
Ndufs3	Rat	nuclear body	located_in	IEA	UniProtKB:O75489\|ensembl:ENSP00000263774	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ndufs3	Rat	nuclear body	located_in	ISO	RGD:1319736\|UniProtKB:O75489-1	1624291		RGD	GO_REF:0000052
Ndufs3	Rat	respiratory chain complex I	part_of	ISO	RGD:1319737	1624291	PMID:18396137, PMID:24154540, PMID:31536960, PMID:38575788	RGD	PMID:18396137\|PMID:24154540\|PMID:31536960\|PMID:38575788
Ndufs3	Rat	respiratory chain complex I	part_of	IEA	UniProtKB:O75489\|ensembl:ENSP00000263774	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ndufs3	Rat	respiratory chain complex I	part_of	IBA	FB:FBgn0266582\|MGI:1915599\|PANTHER:PTN000094349\|UniProtKB:O75489\|UniProtKB:P23709\|UniProtKB:Q95748	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ndufs3	Rat	respiratory chain complex I	part_of	ISO	RGD:1319736	1624291	PMID:12611891, PMID:17209039, PMID:18826940, PMID:31536960	RGD	PMID:12611891\|PMID:17209039\|PMID:18826940\|PMID:31536960

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ndufs3	Rat	NADH dehydrogenase (ubiquinone) activity	contributes_to	ISO	RGD:1319736	1624291	PMID:30140060	RGD	PMID:30140060
Ndufs3	Rat	NADH dehydrogenase (ubiquinone) activity	enables	IEA	InterPro:IPR001268	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ndufs3	Rat	NADH dehydrogenase (ubiquinone) activity	enables	ISO	RGD:1319737	1624291	PMID:31916679, PMID:33148885	RGD	PMID:31916679\|PMID:33148885
Ndufs3	Rat	NADH dehydrogenase (ubiquinone) activity	enables	IEA	UniProtKB:O75489\|ensembl:ENSP00000263774	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ndufs3	Rat	NADH dehydrogenase (ubiquinone) activity	enables	ISO	RGD:1319736	1624291	PMID:14729820	RGD	PMID:14729820
Ndufs3	Rat	NADH dehydrogenase activity	enables	ISO	RGD:1319736	1624291	PMID:11112787, PMID:16826196	RGD	PMID:11112787\|PMID:16826196
Ndufs3	Rat	NADH dehydrogenase activity	enables	IEA	UniProtKB:O75489\|ensembl:ENSP00000263774	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ndufs3	Rat	oxidoreductase activity, acting on NAD(P)H	enables	IEA	InterPro:IPR010218\|InterPro:IPR020396	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ndufs3	Rat	protein binding	enables	ISO	RGD:1319737	1624291	UniProtKB:Q9CQT9 PMID:31536960	RGD	PMID:31536960
Ndufs3	Rat	protein binding	enables	ISO	RGD:1319736	1624291	UniProtKB:O75306\|UniProtKB:P17152\|UniProtKB:P51970\|UniProtKB:Q16718\|UniProtKB:Q5JUW0-3\|UniProtKB:Q66PJ3-4\|UniProtKB:Q99497\|UniProtKB:Q9BU61\|UniProtKB:Q9BUV8\|UniProtKB:Q9H8H3 PMID:15250827, PMID:19463981, PMID:19688755, PMID:19822128, PMID:21310150, PMID:24344204, PMID:27499296, PMID:28514442, PMID:31536960, PMID:32296183, PMID:32814053, PMID:33961781	RGD	PMID:15250827\|PMID:19463981\|PMID:19688755\|PMID:19822128\|PMID:21310150\|PMID:24344204\|PMID:27499296\|PMID:28514442\|PMID:31536960\|PMID:32296183\|PMID:32814053\|PMID:33961781

Molecular Pathway Annotations Click to see Annotation Detail View

Imported Annotations - SMPDB

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ndufs3	Rat	doxorubicin pharmacokinetics pathway		ISO	RGD:1319736	10402751		SMPDB	SMP:00650

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ndufs3	Rat	Alzheimer's disease pathway		IEA		6907045		KEGG	rno:05010
Ndufs3	Rat	Huntington's disease pathway		IEA		6907045		KEGG	rno:05016
Ndufs3	Rat	oxidative phosphorylation pathway		IEA		6907045		KEGG	rno:00190
Ndufs3	Rat	Parkinson's disease pathway		IEA		6907045		KEGG	rno:05012

BioCyc Pathways

aerobic respiration I (cytochrome c)

Disease Annotations Click to see Annotation Detail View

Alzheimer's disease (ISO)

Breast Neoplasms (ISO)

Cardiomegaly (IEP)

Chemical and Drug Induced Liver Injury (ISO)

congenital disorder of glycosylation type IIc (ISO)

Diabetic Nephropathies (IEP)

Experimental Diabetes Mellitus (IEP)

genetic disease (ISO)

intellectual disability (ISO)

Leigh disease (ISO)

mitochondrial complex I deficiency (ISO)

nuclear type mitochondrial complex I deficiency 1 (ISO)

nuclear type mitochondrial complex I deficiency 8 (ISO)

optic atrophy (ISO)

Parkinsonism (IEP)

Subacute Necrotizing Encephalopathy of Leigh, Infantile (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dimethoxyphenol (ISO)

3-methyladenine (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-naphthoflavone (ISO)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (EXP)

Brodifacoum (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

chlorpromazine (EXP)

chlorpyrifos (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

clofibrate (EXP)

clofibric acid (EXP)

clotrimazole (EXP)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

corosolic acid (ISO)

cyclosporin A (ISO)

dibutyl phthalate (EXP)

dichloromethane (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

flutamide (ISO)

furfural (ISO)

genistein (ISO)

isoniazide (ISO)

isoprenaline (EXP)

isotretinoin (ISO)

ivermectin (ISO)

L-methionine (EXP)

lipopolysaccharide (ISO)

methimazole (EXP)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (EXP)

niclosamide (ISO)

nitrates (ISO)

paracetamol (ISO)

paraquat (ISO)

pyrroloquinoline quinone (EXP)

quercetin (ISO)

rac-1,2-dichloropropane (ISO)

resveratrol (ISO)

rotenone (EXP,ISO)

selenium atom (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

T-2 toxin (EXP)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

toluene (EXP)

valproic acid (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

mitochondrial electron transport, NADH to ubiquinone (IEA,ISO)

mitochondrial respiratory chain complex I assembly (IEA,ISO)

proton transmembrane transport (IEA)

reactive oxygen species metabolic process (IEA,ISO)

substantia nigra development (ISO)

Cellular Component

mitochondrial inner membrane (IEA,ISO)

mitochondrial membrane (IEA,ISO)

mitochondrion (IEA,ISO)

nuclear body (IEA,ISO)

respiratory chain complex I (IBA,IEA,ISO)

Molecular Function

NADH dehydrogenase (ubiquinone) activity (IEA,ISO)

NADH dehydrogenase activity (IEA,ISO)

oxidoreductase activity, acting on NAD(P)H (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Alzheimer's disease pathway (IEA)

doxorubicin pharmacokinetics pathway (ISO)

Huntington's disease pathway (IEA)

oxidative phosphorylation pathway (IEA)

Parkinson's disease pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Diminished superoxide generation is associated with respiratory chain dysfunction and changes in the mitochondrial proteome of sensory neurons from diabetic rats.	Akude E, etal., Diabetes. 2011 Jan;60(1):288-97. Epub 2010 Sep 28.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Systems biology approach to late-onset Alzheimer's disease genome-wide association study identifies novel candidate genes validated using brain expression data and Caenorhabditis elegans experiments.	Mukherjee S, etal., Alzheimers Dement. 2017 Oct;13(10):1133-1142. doi: 10.1016/j.jalz.2017.01.016. Epub 2017 Feb 24.
7.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
8.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
9.	Proteomic analysis of expression and protein interactions in a 6-hydroxydopamine-induced rat brain lesion model.	Park B, etal., Neurochem Int. 2010 Aug;57(1):16-32. doi: 10.1016/j.neuint.2010.04.005. Epub 2010 Apr 18.
10.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
11.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Comprehensive gene review and curation	RGD comprehensive gene curation
15.	Compromised mitochondrial remodeling in compensatory hypertrophied myocardium of spontaneously hypertensive rat.	Tang Y, etal., Cardiovasc Pathol. 2013 Nov 14. pii: S1054-8807(13)00200-7. doi: 10.1016/j.carpath.2013.11.002.
16.	Mitochondrial proteome analysis reveals depression of the Ndufs3 subunit and activity of complex I in diabetic rat brain.	Taurino F, etal., J Proteomics. 2012 Apr 18;75(8):2331-41. doi: 10.1016/j.jprot.2012.02.002. Epub 2012 Feb 23.
17.	Gene expression profiling in glomeruli of diabetic nephropathy rat.	Zhang Q, etal., Exp Biol Med (Maywood). 2012 Aug;237(8):903-11. doi: 10.1258/ebm.2012.012032. Epub 2012 Aug 17.
18.	Telmisartan improves kidney function through inhibition of the oxidative phosphorylation pathway in diabetic rats.	Zhang Q, etal., J Mol Endocrinol. 2012 Jun 26;49(1):35-46. doi: 10.1530/JME-12-0020. Print 2012 Aug.

Additional References at PubMed

PMID:11112787	PMID:12611891	PMID:12865426	PMID:14651853	PMID:16826196	PMID:17209039	PMID:17634366	PMID:18396137	PMID:18614015	PMID:19837698	PMID:22926577	PMID:24154540
PMID:30361391	PMID:31536960

Genomics

Comparative Map Data

Ndufs3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	97,332,477 - 97,339,654 (-)	NCBI		GRCr8
mRatBN7.2	3	76,876,646 - 76,883,824 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	76,876,646 - 76,883,824 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	80,354,354 - 80,361,560 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	88,952,835 - 88,960,041 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	86,804,226 - 86,811,400 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	79,721,686 - 79,728,863 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	79,721,694 - 79,728,879 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	86,430,806 - 86,437,983 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	75,256,383 - 75,263,560 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	75,152,762 - 75,159,826 (-)	NCBI
Celera	3	76,085,667 - 76,092,843 (-)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI

NDUFS3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	47,579,074 - 47,584,562 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	47,565,336 - 47,584,562 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	47,600,626 - 47,606,114 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	47,557,208 - 47,562,690 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	47,557,207 - 47,562,689	NCBI
Celera	11	47,743,293 - 47,748,843 (+)	NCBI		Celera
Cytogenetic Map	11	p11.2	NCBI
HuRef	11	47,301,639 - 47,307,200 (+)	NCBI		HuRef
CHM1_1	11	47,599,803 - 47,605,356 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	47,739,496 - 47,744,966 (+)	NCBI		T2T-CHM13v2.0

Ndufs3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	90,724,971 - 90,735,065 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	90,724,978 - 90,735,171 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	90,894,627 - 90,904,721 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	90,894,634 - 90,904,827 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	90,734,793 - 90,744,878 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	90,695,475 - 90,705,560 (-)	NCBI		MGSCv36	mm8
Celera	2	92,279,671 - 92,289,201 (-)	NCBI		Celera
Cytogenetic Map	2	E1	NCBI
cM Map	2	50.44	NCBI

Ndufs3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	709,784 - 717,926 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955422	713,370 - 717,926 (-)	NCBI	ChiLan1.0	ChiLan1.0

NDUFS3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	49,776,948 - 49,788,940 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	49,803,175 - 49,808,697 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	47,528,680 - 47,534,206 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	48,078,332 - 48,083,863 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	48,078,332 - 48,083,863 (+)	Ensembl	panpan1.1		panPan2

NDUFS3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	42,069,402 - 42,075,843 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	42,069,398 - 42,076,921 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	40,800,727 - 40,807,169 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	42,725,265 - 42,731,706 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	42,725,271 - 42,731,666 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	42,212,502 - 42,219,616 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	41,766,818 - 41,773,261 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	42,496,862 - 42,503,304 (-)	NCBI		UU_Cfam_GSD_1.0

Ndufs3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	19,556,138 - 19,563,014 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936562	1,664,293 - 1,674,670 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936562	1,667,780 - 1,674,670 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NDUFS3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	15,031,149 - 15,036,880 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	15,031,147 - 15,036,880 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	16,207,693 - 16,213,425 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NDUFS3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	17,735,040 - 17,740,508 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	17,733,645 - 17,745,677 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	115,027,358 - 115,033,159 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ndufs3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624767	1,237,261 - 1,244,031 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624767	1,238,953 - 1,243,945 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ndufs3
31 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	51
Count of miRNA genes:	48
Interacting mature miRNAs:	49
Transcripts:	ENSRNOT00000012425
Prediction methods:	Microtar, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	43827364	90905114	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	53184692	89878207	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	39454637	89115240	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	78196190	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	15005422	76927699	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	89115240	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	73376539	118376539	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	53781112	91609953	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	38517803	83517803	Rat
631200	Cm25	Cardiac mass QTL 25	4.8	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	3	61134348	89115068	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	41874578	104104347	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat

Markers in Region

RH133959

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	76,876,188 - 76,876,369 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	79,721,229 - 79,721,409	NCBI	Rnor6.0
Rnor_5.0	3	86,430,349 - 86,430,529	UniSTS	Rnor5.0
RGSC_v3.4	3	75,255,926 - 75,256,106	UniSTS	RGSC3.4
Celera	3	76,085,210 - 76,085,390	UniSTS
Cytogenetic Map	3	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106489	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212516	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219879	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229308	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229748	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012425 ⟹ ENSRNOP00000012425

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	76,876,646 - 76,883,824 (-)	Ensembl
Rnor_6.0 Ensembl	3	79,721,694 - 79,728,879 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107192 ⟹ ENSRNOP00000091491

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	76,876,654 - 76,883,664 (-)	Ensembl

RefSeq Acc Id:

NM_001106489 ⟹ NP_001099959

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,332,477 - 97,339,654 (-)	NCBI
mRatBN7.2	3	76,876,646 - 76,883,824 (-)	NCBI
Rnor_6.0	3	79,721,686 - 79,728,863 (-)	NCBI
Rnor_5.0	3	86,430,806 - 86,437,983 (-)	NCBI
RGSC_v3.4	3	75,256,383 - 75,263,560 (-)	RGD
Celera	3	76,085,667 - 76,092,843 (-)	RGD

Sequence:

show sequence

GCGGGTCTTTCTTACCTGCGTTACCTCCTTTCATGCCAATGTTCAGATCCGGAACCTCTGCTTC
CCGCCCCGTGTCCGCCCGGAAGAAGATTCATTGCACATTTCCACTTCCGGTCCGTGCCCTTGAG
GCTCCGTGGCCTGTGTGTGTTTTCCGGCTACTTAGTCGGCACCCTAAGGAACATGGCGTCTGCT
GCAGCCAGGGTCTGGTGCCGTGGGCTCTTGGGGGCTGCTTCCGTAGCCAGGGGGGCTGGGCGAC
CCTCAGTGCTGTTGCAGCAGCGTGTGAGAAGGGAGAGCGCGGCGGCTGACAAGCGCCCCACTGT
CAGACCCTCGAGTGATGTAACCCACAAGCGGCTCTCAGCATTTGGAGAGTATGTGGCTGAAATC
TTACCTAAGTATGTCCAACAAGTTCAGGTGACCTGCTTTGATGAGTTAGAAATCTGCATCCATC
CTGATGGAGTCATCCCAACGATAACCTTTCTCAAGGATCATACCAATGCACAGTTCAAATCCTT
GGCTGACTTGACAGCAGTGGATGTCCCAACTCGGCAGAACCGTTTTGAGATTGTCTACAACCTG
CTGTCCCTGCGGTTTAACTCTAGGATTCGTGTGAAGACCTATGCAGATGAGCTGACAGCCATTG
ACTCCATAGTGTCTGTGCACATTGCGGCCAATTGGTATGAGAGGGAGGTCTGGGACATGTTTGG
AGTTTTCTTCTTCAACCACCCTGACTTGAGAAGGATCCTGACAGATTATGGCTTCGAGGGACAT
CCTTTCCGGAAAGACTTTCCCCTCACTGGCTATGTTGAGCTACGTTATGACGATGAGGTGAAGC
GGGTAGTGGCTGAGCCAGTGGAGTTGGCACAAGAGTTCCGCAAGTTTGACCTGAACAGCCCCTG
GGAGGCTTTCCCTGCCTATCGTCAGCCCCCTGAGCATCTCAAGCTTGAAGCTGGAGACAAGAAG
CCTGAAGCCAAGTAACTTCACAAGATGTAGATCCTAGAGGAAAATGCCTTACCTAAGGTTGTCT
GTAAATAAACTCCAGTGGACATTCACTCCTTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099959	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL79487	(Get FASTA)	NCBI Sequence Viewer
	EDL79488	(Get FASTA)	NCBI Sequence Viewer
	EDL79489	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012425.4
	ENSRNOP00000091491
	ENSRNOP00000091491.1

RefSeq Acc Id:

NP_001099959 ⟸ NM_001106489

- UniProtKB:

D3ZG43 (UniProtKB/TrEMBL), A6HN87 (UniProtKB/TrEMBL), A6HN86 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASAAARVWCRGLLGAASVARGAGRPSVLLQQRVRRESAAADKRPTVRPSSDVTHKRLSAFGEY
VAEILPKYVQQVQVTCFDELEICIHPDGVIPTITFLKDHTNAQFKSLADLTAVDVPTRQNRFEI
VYNLLSLRFNSRIRVKTYADELTAIDSIVSVHIAANWYEREVWDMFGVFFFNHPDLRRILTDYG
FEGHPFRKDFPLTGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYRQPPEHLKLEA
GDKKPEAK

hide sequence

Ensembl Acc Id:

ENSRNOP00000012425 ⟸ ENSRNOT00000012425

Ensembl Acc Id:

ENSRNOP00000091491 ⟸ ENSRNOT00000107192

Protein Domains

NADH:ubiquinone oxidoreductase 30kDa subunit

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZG43-F1-model_v2	AlphaFold	D3ZG43	1-264	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692200

Promoter ID:

EPDNEW_R2725

Type:

multiple initiation site

Name:

Ndufs3_1

Description:

NADH:ubiquinone oxidoreductase core subunit S3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	79,728,710 - 79,728,770	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309406	AgrOrtholog
BioCyc Gene	G2FUF-48759	BioCyc
BioCyc Pathway	PWY-3781 [aerobic respiration I (cytochrome c)]	BioCyc
BioCyc Pathway Image	PWY-3781	BioCyc
Ensembl Genes	ENSRNOG00000009155	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000012425.7	UniProtKB/TrEMBL
	ENSRNOT00000107192	ENTREZGENE
	ENSRNOT00000107192.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.460.80	UniProtKB/TrEMBL
InterPro	NADH_DH_csu	UniProtKB/TrEMBL
	NADH_quin_OxRdtase_su_C/D-like	UniProtKB/TrEMBL
	NADH_UbQ_OxRdtase_30kDa_su	UniProtKB/TrEMBL
	NADH_UbQ_OxRdtase_CS	UniProtKB/TrEMBL
KEGG Report	rno:295923	UniProtKB/TrEMBL
NCBI Gene	295923	ENTREZGENE
PANTHER	NADH DEHYDROGENASE [UBIQUINONE] IRON-SULFUR PROTEIN 3, MITOCHONDRIAL	UniProtKB/TrEMBL
	NADH DEHYDROGENASE UBIQUINONE IRON-SULFUR PROTEIN 3	UniProtKB/TrEMBL
Pfam	Complex1_30kDa	UniProtKB/TrEMBL
PhenoGen	Ndufs3	PhenoGen
PROSITE	COMPLEX1_30K	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000009155	RatGTEx
Superfamily-SCOP	SSF143243	UniProtKB/TrEMBL
UniProt	A0A8I6ADT5_RAT	UniProtKB/TrEMBL
	A6HN86	ENTREZGENE, UniProtKB/TrEMBL
	A6HN87	ENTREZGENE, UniProtKB/TrEMBL
	D3ZG43	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-29	Ndufs3	NADH:ubiquinone oxidoreductase core subunit S3	Ndufs3	NADH dehydrogenase (ubiquinone) Fe-S protein 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Ndufs3	NADH dehydrogenase (ubiquinone) Fe-S protein 3	Ndufs3_predicted	NADH dehydrogenase (ubiquinone) Fe-S protein 3 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Ndufs3_predicted	NADH dehydrogenase (ubiquinone) Fe-S protein 3 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways