Advanced Search (OLGA)

Gene: Mad2l1bp (MAD2L1 binding protein) Rattus norvegicus

Analyze

Symbol:

Mad2l1bp

Name:

MAD2L1 binding protein

RGD ID:

1309175

Description:

Predicted to be involved in deactivation of mitotic spindle assembly checkpoint and regulation of exit from mitosis. Predicted to be located in cytoplasm and nucleus. Orthologous to human MAD2L1BP (MAD2L1 binding protein); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC316237; MAD2L1-binding protein; MGC109107

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MAD2L1BP (MAD2L1 binding protein)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Mad2l1bp (MAD2L1 binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mad2l1bp (MAD2L1 binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MAD2L1BP (MAD2L1 binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MAD2L1BP (MAD2L1 binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mad2l1bp (MAD2L1 binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MAD2L1BP (MAD2L1 binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MAD2L1BP (MAD2L1 binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mad2l1bp (MAD2L1 binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	MAD2L1BP (MAD2L1 binding protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mad2l1bp (MAD2L1 binding protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mad2l1bp (MAD2L1 binding protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG13599	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	22,329,699 - 22,334,024 (+)	NCBI		GRCr8
GRCr8 Ensembl	9	22,329,698 - 22,335,016 (+)	Ensembl		GRCr8 Ensembl
mRatBN7.2	9	14,832,133 - 14,836,458 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	14,832,132 - 14,837,447 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	23,416,692 - 23,421,036 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	28,479,122 - 28,483,457 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	26,780,120 - 26,784,464 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	17,217,141 - 17,221,465 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	17,216,495 - 17,221,434 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	16,112,968 - 16,117,292 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	10,396,316 - 10,401,505 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	9	12,579,446 - 12,583,626 (+)	NCBI		Celera
RGSC_v3.1	9	10,393,637 - 10,398,824 (+)	NCBI
Cytogenetic Map	9	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

infantile Refsum disease (ISO)

Zellweger syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

acrylamide (EXP)

all-trans-retinoic acid (ISO)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) chloride (ISO)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

Dibutyl phosphate (ISO)

disulfiram (ISO)

epoxiconazole (ISO)

fenthion (ISO)

flutamide (EXP)

folic acid (ISO)

methidathion (ISO)

methotrexate (ISO)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

nitrates (ISO)

paracetamol (ISO)

PCB138 (EXP)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

resveratrol (ISO)

triphenyl phosphate (EXP)

triptonide (ISO)

tungsten (ISO)

valproic acid (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

deactivation of mitotic spindle assembly checkpoint (IEA,ISO)

regulation of exit from mitosis (IEA,ISO)

Cellular Component

cytoplasm (IEA,ISO)

nuclear membrane (IEA,ISO)

nucleolus (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IEA,ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10942595	PMID:12456649	PMID:12477932	PMID:18022368

Genomics

Comparative Map Data

Mad2l1bp
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	22,329,699 - 22,334,024 (+)	NCBI		GRCr8
GRCr8 Ensembl	9	22,329,698 - 22,335,016 (+)	Ensembl		GRCr8 Ensembl
mRatBN7.2	9	14,832,133 - 14,836,458 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	14,832,132 - 14,837,447 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	23,416,692 - 23,421,036 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	28,479,122 - 28,483,457 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	26,780,120 - 26,784,464 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	17,217,141 - 17,221,465 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	17,216,495 - 17,221,434 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	16,112,968 - 16,117,292 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	10,396,316 - 10,401,505 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	9	12,579,446 - 12,583,626 (+)	NCBI		Celera
RGSC_v3.1	9	10,393,637 - 10,398,824 (+)	NCBI
Cytogenetic Map	9	q12	NCBI

MAD2L1BP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	43,629,540 - 43,640,941 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	43,629,540 - 43,640,941 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	43,597,277 - 43,608,678 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	43,705,257 - 43,716,667 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	43,711,554 - 43,716,664	NCBI
Celera	6	45,148,900 - 45,160,310 (+)	NCBI		Celera
Cytogenetic Map	6	p21.1	NCBI
HuRef	6	43,316,454 - 43,327,864 (+)	NCBI		HuRef
CHM1_1	6	43,600,342 - 43,611,752 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	43,458,178 - 43,469,674 (+)	NCBI		T2T-CHM13v2.0

Mad2l1bp
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	46,458,311 - 46,464,477 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	46,458,313 - 46,464,479 (-)	Ensembl		GRCm39 Ensembl
GRCm38	17	46,147,385 - 46,153,551 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	46,147,387 - 46,153,553 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	46,284,334 - 46,290,500 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	45,610,970 - 45,617,117 (-)	NCBI		MGSCv36	mm8
Celera	17	49,578,789 - 49,584,951 (-)	NCBI		Celera
Cytogenetic Map	17	C	NCBI
cM Map	17	22.88	NCBI

Mad2l1bp
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955437	9,423,630 - 9,433,357 (+)	NCBI	ChiLan1.0	ChiLan1.0

MAD2L1BP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	58,133,961 - 58,139,117 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	54,003,743 - 54,008,898 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	43,219,638 - 43,230,988 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	44,515,529 - 44,520,288 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	44,509,839 - 44,521,590 (+)	Ensembl	panpan1.1		panPan2

MAD2L1BP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	12,085,825 - 12,089,907 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	12,085,915 - 12,090,411 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	12,112,275 - 12,117,289 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	12,569,776 - 12,574,790 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	12,569,868 - 12,574,332 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	12,094,863 - 12,099,876 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	12,181,890 - 12,186,897 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	12,275,386 - 12,280,401 (+)	NCBI		UU_Cfam_GSD_1.0

Mad2l1bp
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	47,574,303 - 47,580,270 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936476	16,380,356 - 16,385,479 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936476	16,379,932 - 16,385,812 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MAD2L1BP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	38,613,440 - 38,623,832 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	38,613,349 - 38,623,845 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	44,195,882 - 44,206,358 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MAD2L1BP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	28,524,122 - 28,529,162 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	28,524,117 - 28,529,139 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	43,688,591 - 43,693,762 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mad2l1bp
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624754	16,045,331 - 16,047,497 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624754	16,044,275 - 16,047,500 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Mad2l1bp
49 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	49
Count of miRNA genes:	46
Interacting mature miRNAs:	47
Transcripts:	ENSRNOT00000026331
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303170	Bp332	Blood pressure QTL 332	3.73	0.027	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	6714888	84474983	Rat
631211	Bw4	Body weight QTL4	5.31		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	9	5346479	50346479	Rat
2303559	Gluco54	Glucose level QTL 54	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	8750492	53750492	Rat
7207814	Bmd91	Bone mineral density QTL 91	3.5		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	9	1	31250552	Rat
9589055	Scfw5	Subcutaneous fat weight QTL 5	5.55	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	9	496645	45496645	Rat
1641911	Alcrsp13	Alcohol response QTL 13			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	6214995	51214995	Rat
1354650	Despr5	Despair related QTL 5	4.01	0.0017	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	9	8750492	53750492	Rat
1300124	Cm4	Cardiac mass QTL 4	3.55		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	9	1	41763315	Rat
61425	Cia15	Collagen induced arthritis QTL 15	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	9	5346479	50416711	Rat
631643	Bp120	Blood pressure QTL 120	3	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	6714888	29567695	Rat
9589158	Gluco65	Glucose level QTL 65	6.82	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	9	496645	45496645	Rat
1600365	Mcs20	Mammary carcinoma susceptibility QTL 20	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	9	21031430	49025574	Rat
7411592	Foco8	Food consumption QTL 8	7.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	496645	45496645	Rat
1298088	Edpm11	Estrogen-dependent pituitary mass QTL 11	2.5		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	6214995	51214995	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001009699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC088268	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473987	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026331 ⟹ ENSRNOP00000026331

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	22,329,698 - 22,335,016 (+)	Ensembl
mRatBN7.2 Ensembl	9	14,832,132 - 14,837,447 (+)	Ensembl
Rnor_6.0 Ensembl	9	17,216,495 - 17,221,434 (+)	Ensembl

RefSeq Acc Id:

NM_001009699 ⟹ NP_001009699

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	22,329,699 - 22,334,024 (+)	NCBI
mRatBN7.2	9	14,832,133 - 14,836,458 (+)	NCBI
Rnor_6.0	9	17,217,141 - 17,221,465 (+)	NCBI
Rnor_5.0	9	16,112,968 - 16,117,292 (+)	NCBI
RGSC_v3.4	9	10,396,316 - 10,401,505 (+)	RGD
Celera	9	12,579,446 - 12,583,626 (+)	RGD

Sequence:

show sequence

GTCACGATGGCCGCATCCGGGCAGGAGGATCGGTCGGAGCTGTCCCCTGCTGCTGCCCCAAATT
TGGATTGGACTGAGAAACCGGAAGAAACTCGTGCACCCGGGGTAGATCTTGAGACCGTCATCCC
GCCAGTCCAGGAACCTTCCAATTCTGTGGAGCCCTTTTGCCCAAGAGACCTGGTACCGGTGGTG
TTTCCTGGACCCGTGAGCCAGGAAGGCTGCTGCCAGTTCACTTGTGAACTTCTAAAGCATATCA
TGTACCAACGCCAACAGCTCCCTTTGCCCTATGAACAGCTGAAGCACTTCTACCAGAAATCTTC
TCCCCAGGCAGAGGACACAGCAAGGAAGAAACCTCGGCTCACCACTGAGGCGAGTAACAGGAAG
TGTCAGCAGGCTCTGGCGGAACTGGAGAGTGTCCTCAGTCACCTACGAGACTTCTTTGCCCGAA
CACTAGTGCCACAAGTGTTGATCCTTCTTGGAGGCAATGCCCTCAGCCCCAAAGAATTCTATGA
ACTCGACCTGTCCAGGCTGGCCCCGTTCAGTGTGGACCAGGGCCTGAACACAGCAGCGTGCTTG
CGTCATCTCTTCAGAGCCATCTTCTTGGCGGATGCATTTAGTGAGCTGCAGGCTCCCCCACTCA
TGGGTACCATTGTCATGGTACAGGGCCACCGTGACTGTGGAGAAGATTGGTTTCGACCCAAATT
AAACTACCGGGTGCCCAGCCGGGGTCACAAACTCACCGTGACACTGTCCTGTGGTAGACCTTCC
GTCCCAGCCATGGCTTCCGAGGATTACATTTGGTTCCAGGCACCAGTGACACTTAAAGGTTTCC
ATGAGTGAATGTATAAGGACATTGGCTGAATCCTCTCCCCATCTCGTGCCAAGGCACTGATCTC
TCCGCTGAGGGAGGAAAGCTCTTTCCTGGCTGTGTGCCTCTCCCCAGATTTCCTGGTGTGTGGT
TCTGACTGTGAGAATCGTCATCAAGCAAAGCCCTCGAATTGATGATTGACTCCCAGAAGCCCCT
GTGCCAGGTGGTTCTGTTTGGGAGTAGAAAGCAAGGCTGTGTGGGTAGATCCTCTAATGGACGT
GGTCTTTCTCCGCTTTATGCTGTGCGTTTTCAGAACTGGTGCCAGAATCATAATATGGATGTGA
CTCATGAATTTGAATGATGAGATGAATAGATCAGTATTAAAATTTTTTAACGCTTTTGATTTAG
ACTTTTGGCCTTGAGGCTCAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001009699	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88268	(Get FASTA)	NCBI Sequence Viewer
	EDM18796	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026331
	ENSRNOP00000026331.4

RefSeq Acc Id:

NP_001009699 ⟸ NM_001009699

- UniProtKB:

Q5I0J2 (UniProtKB/TrEMBL), A6JIT6 (UniProtKB/TrEMBL), F7FQE7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAASGQEDRSELSPAAAPNLDWTEKPEETRAPGVDLETVIPPVQEPSNSVEPFCPRDLVPVVFP
GPVSQEGCCQFTCELLKHIMYQRQQLPLPYEQLKHFYQKSSPQAEDTARKKPRLTTEASNRKCQ
QALAELESVLSHLRDFFARTLVPQVLILLGGNALSPKEFYELDLSRLAPFSVDQGLNTAACLRH
LFRAIFLADAFSELQAPPLMGTIVMVQGHRDCGEDWFRPKLNYRVPSRGHKLTVTLSCGRPSVP
AMASEDYIWFQAPVTLKGFHE

hide sequence

Ensembl Acc Id:

ENSRNOP00000026331 ⟸ ENSRNOT00000026331

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5I0J2-F1-model_v2	AlphaFold	Q5I0J2	1-277	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696534

Promoter ID:

EPDNEW_R7058

Type:

initiation region

Name:

Mad2l1bp_1

Description:

MAD2L1 binding protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	17,217,140 - 17,217,200	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309175	AgrOrtholog
BioCyc Gene	G2FUF-28204	BioCyc
Ensembl Genes	ENSRNOG00000019463	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000026331	ENTREZGENE
	ENSRNOT00000026331.7	UniProtKB/TrEMBL
Gene3D-CATH	3.30.900.20	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7379293	IMAGE-MGC_LOAD
InterPro	MAD2L1_bd	UniProtKB/TrEMBL
	MAD2L1BP_domain_sf	UniProtKB/TrEMBL
KEGG Report	rno:316237	UniProtKB/TrEMBL
MGC_CLONE	MGC:109107	IMAGE-MGC_LOAD
NCBI Gene	316237	ENTREZGENE
PANTHER	MAD2L1-BINDING PROTEIN	UniProtKB/TrEMBL
	PTHR15681	UniProtKB/TrEMBL
Pfam	DUF1135	UniProtKB/TrEMBL
PhenoGen	Mad2l1bp	PhenoGen
RatGTEx	ENSRNOG00000019463	RatGTEx
UniProt	A6JIT6	ENTREZGENE, UniProtKB/TrEMBL
	F7FQE7	ENTREZGENE, UniProtKB/TrEMBL
	Q5I0J2	ENTREZGENE
UniProt Secondary	Q5I0J2	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Mad2l1bp	MAD2L1 binding protein	Mad2l1bp_predicted	MAD2L1 binding protein (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Mad2l1bp_predicted	MAD2L1 binding protein (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar