Dmac1 (distal membrane arm assembly component 1)

Advanced Search (OLGA)

Gene: Dmac1 (distal membrane arm assembly component 1) Rattus norvegicus

Analyze

Symbol:

Dmac1

Name:

distal membrane arm assembly component 1

RGD ID:

1309148

Description:

Predicted to be involved in mitochondrial respiratory chain complex I assembly. Predicted to be located in mitochondrion. Predicted to be active in mitochondrial inner membrane. Orthologous to human DMAC1 (distal membrane arm assembly component 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

distal membrane arm assembly complex 1; distal membrane-arm assembly complex protein 1; LOC298147; RGD1309148; similar to RIKEN cDNA 3110001D03; Tmem261; transmembrane protein 261; transmembrane protein C9orf123 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	94,288,900 - 94,290,053 (-)	NCBI		GRCr8
mRatBN7.2	5	89,241,173 - 89,243,793 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	89,242,661 - 89,243,757 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	91,666,478 - 91,667,577 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	93,495,538 - 93,496,637 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	93,477,303 - 93,478,402 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	92,038,050 - 92,039,146 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	92,038,050 - 92,039,146 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	96,088,255 - 96,089,351 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	93,253,890 - 93,254,986 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	93,259,000 - 93,278,262 (-)	NCBI
Celera	5	87,927,214 - 87,928,367 (-)	NCBI		Celera
Cytogenetic Map	5	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

chromosome 9p deletion syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (EXP)

acrylamide (ISO)

all-trans-retinoic acid (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

chlorpyrifos (ISO)

cobalt dichloride (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

doxorubicin (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

folic acid (ISO)

gentamycin (EXP)

ketamine (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

methylparaben (ISO)

pentanal (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

thiram (ISO)

tolcapone (EXP)

trichloroethene (EXP)

tris(2-butoxyethyl) phosphate (ISO)

trovafloxacin (ISO)

urethane (ISO)

valproic acid (ISO)

venlafaxine hydrochloride (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

mitochondrial respiratory chain complex I assembly (IBA,ISO)

Cellular Component

mitochondrial inner membrane (IBA,ISO)

mitochondrion (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:27626371	PMID:34800366

Genomics

Comparative Map Data

Dmac1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	94,288,900 - 94,290,053 (-)	NCBI		GRCr8
mRatBN7.2	5	89,241,173 - 89,243,793 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	89,242,661 - 89,243,757 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	91,666,478 - 91,667,577 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	93,495,538 - 93,496,637 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	93,477,303 - 93,478,402 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	92,038,050 - 92,039,146 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	92,038,050 - 92,039,146 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	96,088,255 - 96,089,351 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	93,253,890 - 93,254,986 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	93,259,000 - 93,278,262 (-)	NCBI
Celera	5	87,927,214 - 87,928,367 (-)	NCBI		Celera
Cytogenetic Map	5	q31	NCBI

DMAC1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	7,796,500 - 7,799,778 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	7,796,500 - 7,888,380 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	7,796,500 - 7,799,778 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	7,786,490 - 7,789,799 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	9	7,726,922 - 7,730,231 (-)	NCBI		Celera
Cytogenetic Map	9	p24.1	NCBI
HuRef	9	7,752,456 - 7,755,756 (-)	NCBI		HuRef
CHM1_1	9	7,796,308 - 7,799,609 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	7,799,153 - 7,802,419 (-)	NCBI		T2T-CHM13v2.0

Dmac1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	75,195,588 - 75,196,529 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	75,195,591 - 75,196,542 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	75,277,351 - 75,278,292 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	75,277,354 - 75,278,305 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	74,923,258 - 74,924,190 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	74,748,585 - 74,749,517 (-)	NCBI		MGSCv36	mm8
Celera	4	73,760,564 - 73,761,496 (-)	NCBI		Celera
Cytogenetic Map	4	C3	NCBI
cM Map	4	36.66	NCBI

Dmac1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955434	11,530,790 - 11,531,883 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955434	11,530,632 - 11,539,237 (-)	NCBI	ChiLan1.0	ChiLan1.0

DMAC1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	116,793,385 - 116,794,851 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	116,799,330 - 116,800,798 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	7,593,380 - 7,596,687 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	7,767,675 - 7,770,980 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	7,767,678 - 7,770,977 (-)	Ensembl	panpan1.1		panPan2

DMAC1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	28,658,157 - 28,660,697 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	28,659,279 - 28,660,692 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	27,448,248 - 27,450,801 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	29,529,630 - 29,532,230 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	29,529,615 - 29,532,233 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	28,253,312 - 28,255,874 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	28,072,253 - 28,074,802 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	28,731,030 - 28,733,612 (-)	NCBI		UU_Cfam_GSD_1.0

Dmac1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	143,646,765 - 143,648,339 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936539	2,099,147 - 2,101,032 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936539	2,099,563 - 2,100,968 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DMAC1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	214,448,041 - 214,455,912 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	214,452,600 - 214,454,279 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	239,642,011 - 239,643,724 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DMAC1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	71,753,498 - 71,755,037 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	71,753,572 - 71,756,955 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	60,086,304 - 60,089,849 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Dmac1
16 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	332
Count of miRNA genes:	190
Interacting mature miRNAs:	216
Transcripts:	ENSRNOT00000031852
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
1357396	Bw44	Body weight QTL 44	4.19		body mass (VT:0001259)	body weight (CMO:0000012)	5	68984307	104251008	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
61380	Edpm5	Estrogen-dependent pituitary mass QTL 5	4.5	0.92	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	5	68984307	104251008	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1298070	Scl18	Serum cholesterol level QTL 18	3.7		blood LDL cholesterol amount (VT:0000181)	calculated plasma low density lipoprotein cholesterol level (CMO:0001245)	5	79584860	124584860	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
61386	Bp49	Blood pressure QTL 49	16.6		cerebrum integrity trait (VT:0010549)	brain infarction volume (CMO:0001013)	5	60293434	98603051	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
2302381	Bw84	Body weight QTL 84	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	68984307	104251008	Rat
1357402	Bw46	Body weight QTL 46	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	68984307	104251008	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
1331782	Rf36	Renal function QTL 36	3.296		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	83840598	97059958	Rat
1598859	Cm66	Cardiac mass QTL 66	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	79584860	124584860	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	87468046	132468046	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
1598846	Bp293	Blood pressure QTL 293	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	79584860	124584860	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
1298086	Bp156	Blood pressure QTL 156			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	84132602	129132602	Rat
2290005	Mcs24	Mammary carcinoma susceptibility QTL 24			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	64719390	109719390	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	66174080	124160948	Rat
2316954	Rf57	Renal function QTL 57	0		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	59793528	90450144	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
2312671	Scl64	Serum cholesterol level QTL 64		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	68984307	104251008	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	87765973	132765973	Rat
2316957	Pur21	Proteinuria QTL 21	6.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	5	59793528	113558156	Rat

Markers in Region

RH127872

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	89,242,850 - 89,243,063 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	92,038,240 - 92,038,452	NCBI	Rnor6.0
Rnor_5.0	5	96,088,445 - 96,088,657	UniSTS	Rnor5.0
RGSC_v3.4	5	93,254,080 - 93,254,292	UniSTS	RGSC3.4
Celera	5	87,927,404 - 87,927,616	UniSTS
RH 3.4 Map	5	689.6	UniSTS
Cytogenetic Map	5	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001206675	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109504	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473978	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227858	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000031852 ⟹ ENSRNOP00000029921

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	89,242,661 - 89,243,757 (-)	Ensembl
Rnor_6.0 Ensembl	5	92,038,050 - 92,039,146 (-)	Ensembl

RefSeq Acc Id:

NM_001206675 ⟹ NP_001193604

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	94,288,900 - 94,289,996 (-)	NCBI
mRatBN7.2	5	89,242,661 - 89,243,757 (-)	NCBI
Rnor_6.0	5	92,038,050 - 92,039,146 (-)	NCBI
Rnor_5.0	5	96,088,255 - 96,089,351 (-)	NCBI
Celera	5	87,927,214 - 87,928,367 (-)	NCBI

Sequence:

show sequence

AAGGTTGTGCCCTCTTTTGATATGGGTTCCTCGTTTTCGAGTAGCAGTGAGTTTCCTGCTCAGG
ACTCCACAGCTGCGCTCACAGCTTCTTCCTCAAACCCACCCGCGAAAGCCGCCGTGTCGGCCTC
TTCCGCACAGGACCCCGTGTTAAAGAACTGCTGGAGTTGTCGCGTGCTGTCTGGCTCTACGCTC
TTAGGGGCGGGTACCTACGTCTACTTTGTTGCCAGGCGGCCCTTGAAGCAAGGATTCCCTCCTG
GCCCAGGCACTGTGGTGCAGATGGTCACCGGCATCAGTATTGCCTGTTGGGGTGTAATTGTTCT
GATAGACCCCAAAGGGAAGGACCACCAAGATGTTTGAAAATACCAGCAGTTCATTGTTGTCTCC
TATCACTGGCTGCGCGGCAGACGGAACAAGCATTGGGTTGGTGGATATTCTTTGCACACACTGC
CAAGGATGCGCTTAACCATAGGACATACCGAGAAGACCGTGAAAATATGAGCTGTCATTCTTTG
GCCATGGATCCTTACGGTTTACCCCCTCTCAGGTTATAAAGGGACAAAAAAATCCCTTGGAAGA
AAACATGATTCTCTGTCTTGTCCAGGGAGGTTATGTGTAGTTCAATTTATACTCAAAGATAACG
TTTTGAGAACATATTAAAATGGGATGAATGGTAGGCCAATAATGAAATAAACTATTTTTTTAAA
ATAATAAGTAGTTCTTTTAATTTTTCTTATCATATCAACAGCTCTTGGCAACCTAACCTTGAAT
AATTACATGGAAGTTGTTCATGCTTTCCAAAGTTTCTTCAAGTCCATCACTGAATGAGAGCTGC
TTATTTGTTATTTCAGCTGTAAGCCTTGGACCTAGCTATT

hide sequence

RefSeq Acc Id:

XM_039109504 ⟹ XP_038965432

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	94,289,064 - 94,290,053 (-)	NCBI
mRatBN7.2	5	89,241,173 - 89,243,793 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001193604	(Get FASTA)	NCBI Sequence Viewer
	XP_038965432	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM10488	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000029921.5

RefSeq Acc Id:	NP_001193604 ⟸ NM_001206675
- UniProtKB:	D4AEL3 (UniProtKB/TrEMBL), A6J819 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGSSFSSSSEFPAQDSTAALTASSSNPPAKAAVSASSAQDPVLKNCWSCRVLSGSTLLGAGTYV YFVARRPLKQGFPPGPGTVVQMVTGISIACWGVIVLIDPKGKDHQDV hide sequence

Ensembl Acc Id:

ENSRNOP00000029921 ⟸ ENSRNOT00000031852

RefSeq Acc Id:	XP_038965432 ⟸ XM_039109504
- Peptide Label:	isoform X1
- UniProtKB:	A6J818 (UniProtKB/TrEMBL)

Protein Domains

Distal membrane-arm assembly complex protein 1-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4AEL3-F1-model_v2	AlphaFold	D4AEL3	1-111	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693814

Promoter ID:

EPDNEW_R4339

Type:

initiation region

Name:

Dmac1_1

Description:

distal membrane arm assembly complex 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	92,039,133 - 92,039,193	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309148	AgrOrtholog
BioCyc Gene	G2FUF-40957	BioCyc
Ensembl Genes	ENSRNOG00000023946	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000031852.6	UniProtKB/TrEMBL
InterPro	DMAC_Protein	UniProtKB/TrEMBL
	DUF4536	UniProtKB/TrEMBL
KEGG Report	rno:298147	UniProtKB/TrEMBL
NCBI Gene	298147	ENTREZGENE
PANTHER	DISTAL MEMBRANE-ARM ASSEMBLY COMPLEX PROTEIN 1	UniProtKB/TrEMBL
	DISTAL MEMBRANE-ARM ASSEMBLY COMPLEX PROTEIN 1	UniProtKB/TrEMBL
Pfam	DUF4536	UniProtKB/TrEMBL
PhenoGen	Dmac1	PhenoGen
RatGTEx	ENSRNOG00000023946	RatGTEx
UniProt	A6J818	ENTREZGENE, UniProtKB/TrEMBL
	A6J819	ENTREZGENE, UniProtKB/TrEMBL
	D4AEL3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-02-18	Dmac1	distal membrane arm assembly component 1	Dmac1	distal membrane arm assembly complex 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2017-06-19	Dmac1	distal membrane arm assembly complex 1	Tmem261	transmembrane protein 261	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-11-22	Tmem261	transmembrane protein 261	RGD1309148	similar to RIKEN cDNA 3110001D03	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1309148	similar to RIKEN cDNA 3110001D03	RGD1309148_predicted	similar to RIKEN cDNA 3110001D03 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-20	RGD1309148_predicted	similar to RIKEN cDNA 3110001D03 (predicted)	LOC298147_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC298147_predicted	similar to RIKEN cDNA 3110001D03 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar