Ctsa (cathepsin A) - Rat Genome Database

Name: Ctsa
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Ctsa (cathepsin A) Rattus norvegicus

Analyze

Symbol:

Ctsa

Name:

cathepsin A

RGD ID:

1309070

Description:

Predicted to enable serine-type carboxypeptidase activity. Predicted to be involved in negative regulation of chaperone-mediated autophagy; proteolysis; and regulation of protein stability. Predicted to be located in intracellular membrane-bounded organelle. Human ortholog(s) of this gene implicated in galactosialidosis and lysosomal storage disease. Orthologous to human CTSA (cathepsin A); PARTICIPATES IN renin-angiotensin cascade pathway; INTERACTS WITH (+)-schisandrin B; 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC296370; lysosomal protective protein; Ppgb; protective protein for beta-galactosidase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CTSA (cathepsin A)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Ctsa (cathepsin A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ctsa (cathepsin A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CTSA (cathepsin A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CTSA (cathepsin A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ctsa (cathepsin A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CTSA (cathepsin A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CTSA (cathepsin A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ctsa (cathepsin A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CTSA (cathepsin A)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ctsa (cathepsin A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ctsa (cathepsin A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F13D12.6	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F41C3.5	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ctsa-1	Alliance	DIOPT (OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ctsa-2	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	ctsa	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	173,988,443 - 173,994,320 (+)	NCBI		GRCr8
mRatBN7.2	3	153,569,106 - 153,574,983 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	153,568,381 - 153,576,215 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	157,377,572 - 157,383,424 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	165,876,542 - 165,882,394 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	163,620,317 - 163,626,169 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	161,298,750 - 161,304,627 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	161,298,962 - 161,304,625 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	167,483,817 - 167,489,976 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	155,866,335 - 155,871,998 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	155,772,370 - 155,778,034 (+)	NCBI
Celera	3	152,176,711 - 152,182,414 (+)	NCBI		Celera
Cytogenetic Map	3	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenosine deaminase deficiency (ISO)

epilepsy (ISO)

focal epilepsy (ISO)

galactosialidosis (ISO)

genetic disease (ISO)

Hydrops Fetalis (ISO)

lysosomal storage disease (ISO)

T-Cell Immunodeficiency, Recurrent Infections, and Autoimmunity with or without Cardiac Malformations (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

3',5'-cyclic AMP (EXP)

4,4'-sulfonyldiphenol (EXP,ISO)

aconitine (EXP)

actinomycin D (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ampicillin (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

bleomycin A2 (ISO)

butanal (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chloroquine (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

clofibrate (ISO)

copper atom (ISO)

copper(0) (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

diethylstilbestrol (ISO)

divanadium pentaoxide (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

epoxiconazole (ISO)

fenthion (ISO)

flutamide (EXP)

folic acid (ISO)

genistein (ISO)

gentamycin (EXP)

glafenine (EXP)

glycidyl methacrylate (ISO)

ivermectin (ISO)

L-cysteine (EXP)

lead diacetate (EXP,ISO)

methidathion (ISO)

metronidazole (EXP)

N-methyl-4-phenylpyridinium (ISO)

neomycin (EXP)

Nutlin-3 (ISO)

ochratoxin A (EXP)

paracetamol (ISO)

paraquat (ISO)

perfluorododecanoic acid (EXP)

pirinixic acid (ISO)

quizartinib (ISO)

rac-lactic acid (ISO)

remdesivir (ISO)

selenium atom (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

Soman (EXP)

T-2 toxin (ISO)

tamibarotene (ISO)

temozolomide (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

thiram (ISO)

triptonide (ISO)

valproic acid (EXP,ISO)

vancomycin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

negative regulation of chaperone-mediated autophagy (ISO)

proteolysis (ISO)

regulation of protein stability (ISO)

Cellular Component

intracellular membrane-bounded organelle (IEA,ISO)

Molecular Function

protein binding (ISO)

serine-type carboxypeptidase activity (IBA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

renin-angiotensin cascade pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Cathepsin A regulates chaperone-mediated autophagy through cleavage of the lysosomal receptor.	Cuervo AM, etal., EMBO J. 2003 Jan 2;22(1):47-59.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Comprehensive gene review and curation	RGD comprehensive gene curation
11.	Protective protein gene mutations in galactosialidosis.	Shimmoto M, etal., J Clin Invest. 1993 Jun;91(6):2393-8.

Additional References at PubMed

PMID:12477932	PMID:14651853	PMID:19056867	PMID:19946888	PMID:23376485	PMID:23533145	PMID:27032673

Genomics

Comparative Map Data

Ctsa
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	173,988,443 - 173,994,320 (+)	NCBI		GRCr8
mRatBN7.2	3	153,569,106 - 153,574,983 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	153,568,381 - 153,576,215 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	157,377,572 - 157,383,424 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	165,876,542 - 165,882,394 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	163,620,317 - 163,626,169 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	161,298,750 - 161,304,627 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	161,298,962 - 161,304,625 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	167,483,817 - 167,489,976 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	155,866,335 - 155,871,998 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	155,772,370 - 155,778,034 (+)	NCBI
Celera	3	152,176,711 - 152,182,414 (+)	NCBI		Celera
Cytogenetic Map	3	q42	NCBI

CTSA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	45,891,335 - 45,898,820 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	45,890,144 - 45,898,949 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	44,519,974 - 44,527,459 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	43,952,998 - 43,960,866 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	43,953,612 - 43,960,863	NCBI
Celera	20	41,231,053 - 41,238,921 (+)	NCBI		Celera
Cytogenetic Map	20	q13.12	NCBI
HuRef	20	41,261,571 - 41,269,436 (+)	NCBI		HuRef
CHM1_1	20	44,422,715 - 44,430,579 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	47,627,833 - 47,635,315 (+)	NCBI		T2T-CHM13v2.0

Ctsa
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	164,674,792 - 164,682,952 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	164,674,793 - 164,682,952 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	164,832,872 - 164,841,032 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	164,832,873 - 164,841,032 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	164,658,373 - 164,666,532 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	164,524,078 - 164,532,237 (+)	NCBI		MGSCv36	mm8
Celera	2	170,770,535 - 170,778,698 (+)	NCBI		Celera
Cytogenetic Map	2	H3	NCBI
cM Map	2	85.27	NCBI

Ctsa
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955445	11,399,151 - 11,405,069 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955445	11,399,151 - 11,405,069 (-)	NCBI	ChiLan1.0	ChiLan1.0

CTSA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	51,631,610 - 51,640,169 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	51,625,703 - 51,633,277 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	42,229,064 - 42,237,627 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	43,315,722 - 43,324,671 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	43,316,530 - 43,324,671 (+)	Ensembl	panpan1.1		panPan2

CTSA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	33,183,090 - 33,189,248 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	33,183,090 - 33,189,248 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	32,710,110 - 32,716,269 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	33,893,407 - 33,899,565 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	33,893,230 - 33,902,559 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	33,151,886 - 33,158,036 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	33,267,003 - 33,273,167 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	33,806,176 - 33,812,343 (+)	NCBI		UU_Cfam_GSD_1.0

Ctsa
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	191,677,621 - 191,683,147 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936514	7,130,848 - 7,136,536 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936514	7,131,263 - 7,136,775 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CTSA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	48,082,448 - 48,089,971 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	48,082,480 - 48,089,971 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	53,729,009 - 53,736,612 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CTSA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	17,986,036 - 17,993,866 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	17,984,310 - 17,993,489 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666050	66,625,707 - 66,634,343 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ctsa
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624790	8,686,027 - 8,691,898 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624790	8,686,027 - 8,692,119 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ctsa
32 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	455
Count of miRNA genes:	228
Interacting mature miRNAs:	262
Transcripts:	ENSRNOT00000066028
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2301411	Bp320	Blood pressure QTL 320		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	145925360	166177555	Rat
12879876	Bw182	Body weight QTL 182		0.003	body mass (VT:0001259)	body weight (CMO:0000012)	3	145925360	166177555	Rat
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
1300113	Bp176	Blood pressure QTL 176	3.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	145956084	157309487	Rat
12879872	Cm97	Cardiac mass QTL 97		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	145925360	166177555	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
12879873	Cm96	Cardiac mass QTL 96		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	145925360	166177555	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
12879874	Cm98	Cardiac mass QTL 98		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	145925360	166177555	Rat
1298068	Bp167	Blood pressure QTL 167		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141074471	169034231	Rat
12879875	Kidm64	Kidney mass QTL 64		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	145925360	166177555	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2298477	Eau4	Experimental allergic uveoretinitis QTL 4		0.0011	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	3	137398739	169034231	Rat
8552791	Vie2	Viral induced encephalitis QTL 2	4.1		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	3	145956084	169034231	Rat
61335	Bp20	Blood pressure QTL 20	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141339236	155617360	Rat
2317883	Alcrsp26	Alcohol response QTL 26	1.8	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	3	145526770	169034231	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1331726	Bp208	Blood pressure QTL 208	3.129		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	141339013	162184794	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1598854	Memor10	Memory QTL 10	2		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	3	145956084	161299569	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1578666	Vnigr1	Vascular neointimal growth QTL 1	4.6		artery morphology trait (VT:0002191)	artery lumen area (CMO:0001409)	3	149040888	168026850	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
8552952	Pigfal13	Plasma insulin-like growth factor 1 level QTL 13			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	138799500	169034231	Rat
12879871	Am7	Aortic mass QTL 7		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	145925360	166177555	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat

Markers in Region

AA891893

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	153,574,324 - 153,574,723 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	161,303,969 - 161,304,367	NCBI	Rnor6.0
Rnor_5.0	3	167,489,318 - 167,489,716	UniSTS	Rnor5.0
RGSC_v3.4	3	155,871,342 - 155,871,740	UniSTS	RGSC3.4
Celera	3	152,181,930 - 152,182,328	UniSTS
RH 3.4 Map	3	1424.1	UniSTS
Cytogenetic Map	3	q42	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

alimentary part of gastrointestinal system

circulatory system

endocrine system

exocrine system

hemolymphoid system

hepatobiliary system

integumental system

musculoskeletal system

nervous system

renal system

reproductive system

respiratory system

appendage

High

Medium

141

227

147

250

103

131

Low

Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001011959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC105815	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078934	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212992	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219992	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229081	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000066028 ⟹ ENSRNOP00000062425

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	153,568,381 - 153,574,978 (+)	Ensembl
Rnor_6.0 Ensembl	3	161,298,962 - 161,304,625 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105075 ⟹ ENSRNOP00000097812

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	153,568,837 - 153,576,215 (+)	Ensembl

RefSeq Acc Id:

NM_001011959 ⟹ NP_001011959

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	173,988,443 - 173,994,320 (+)	NCBI
mRatBN7.2	3	153,569,106 - 153,574,983 (+)	NCBI
Rnor_6.0	3	161,298,750 - 161,304,627 (+)	NCBI
Rnor_5.0	3	167,483,817 - 167,489,976 (+)	NCBI
RGSC_v3.4	3	155,866,335 - 155,871,998 (+)	RGD
Celera	3	152,176,711 - 152,182,414 (+)	NCBI

Sequence:

show sequence

AACACCAAAATCATCTGATTTCTGGCACCCTGACTGTGCACTTTGGGCTGTGCACTTTGACCTG
GTAATTGACCGCCCCCGACCCTCAGATAAAAAAAGTGAACGCTGAGCAAGCTGTCACGTGCTGC
AGAAGCTCACGTGACCAGAACTACACATGACTTCCAGTCCAAAGGCGGCTCCAGGAGAGCAAGG
ACACAAGGAAGCAGAGATGCCCCGAGCAGCACTGTCTCCACTGCTCCTGCTGCTGCTCCTATCC
TGGGCGTCCCGGGACGAAGCAGCTCCGGACCAGGATGAAATCGATTGCCTCCCGGGCCTGGCCA
AGCAGCCCTCTTTCCGGCAGTACTCCGGCTATCTCAAAGCATCGGATTCCAAGCACTTCCACTA
CTGGTTTGTGGAATCGCAGAACGACCCTAAGAACAGCCCCGTGGTGCTTTGGCTCAATGGGGGT
CCTGGCTGCAGCTCCCTAGATGGGTTACTTACAGAGCACGGTCCCTTCCTGATCCAGCCAGATG
GTGTCACCCTGGAGTACAACCCCTATTCTTGGAACCTGATTGCCAACATGCTGTATATCGAGTC
CCCAGCTGGGGTGGGCTTCTCCTACTCGGATGACAAGATGTATGTGACCAATGACACAGAGGTG
GCTGAGAACAATTATCAAGCCCTTAAAGACTTCTACCACCTCTTTCCGGAGTACAAGGACAACA
AACTTTTCCTGACCGGAGAGAGCTATGCTGGCATCTACATCCCCACCTTGGCTGTACTGGTCAT
GCAGGATCCCAGCATGAACCTTCAGGGGCTGGCTGTGGGCAATGGACTCTCCTCCTATGAGCAG
AATGACAACTCCCTGGTCTACTTTGCCTACTACCATGGTCTTCTGGGGAACAGGCTTTGGACTT
CACTCCAGACCCACTGCTGTTCTCAGAACAAGTGTAACTTCTATGACAACAAAGATCCAGATTG
TGTAAACAATCTCCAGGAAGTGTCTCGAATTGTGGGCAAATCTGGCCTCAACATATACAATCTC
TACGCCCCGTGTGCTGGTGGGGTACCCGGCCGTGATAGGTCTGAGGACACACTTGTAGTCCAGG
ATTTTGGCAATATCTTCACTCGCTTGCCACTCAAGAGGAGATTTCCTGAGGCTCTACTGCTTCG
GTCTGGGGACAAGGTACGCTTGGATCCTCCATGCACCAACACCACAGCCCCCTCCACCTACCTC
AACAACCCATATGTTCGGAAGGCTCTCCACATCCCGGAGTCGCTGCCCCGCTGGGACATGTGCA
ACCTCATGGTGAACTTACAGTACCGCCGTCTCTACGAAAGCATGAACTCCCAGTACCTGAAGTT
GCTCAGCTCACAGAAATACCAGATCCTGCTTTACAATGGCGATGTGGACATGGCCTGCAACTTC
ATGGGGGATGAGTGGTTTGTGGATTCCCTCAACCAGAAGATGGAGGTGCAGCGCCGGCCCTGGC
TAGTGGACTACGGGGAGAGTGGAGAGCAGGTAGCTGGCTTTGTGAAGGAATGCTCACACATTAC
CTTCCTCACCATCAAGGGTGCCGGACACATGGTCCCCACGGACAAGCCTCGAGCTGCTTTTACC
ATGTTCTCTCGATTCCTGAACAAGGAGCCTTACTGATAGCTTCGAGGACCCATGGAAGTCCTCA
GCACCTGATCAGACCCTCAAAGCCTCTCTCGATGTCGAGGACTCCTCCTTTATGCAAAGTGCTC
CCGTGGGGCAAGTCCTGCTTTAAAAATGCCCAGGCTTCCTACAGCCCTGTGCATCCCAGCCTGG
GCCTTGGGGCTTCACAGACAGTCTGGGACCAAATGAACACTTTGTTCTGGCTTTGATAGGATGG
CTTTCCCTGGTCTGCATAAAAAATGCCCCATCCCAGGACCCCAACAGAGCTCTAGAGAAGCCCA
AGGAGAGGGTTGGATGGATTGTAATTGATGGTTGACTGATTATGGAATTAAATCGGGTATAGCT
TCCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001011959	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH78934	(Get FASTA)	NCBI Sequence Viewer
	EDL96486	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000062425.2
	ENSRNOP00000097812.1

RefSeq Acc Id:	NP_001011959 ⟸ NM_001011959
- Peptide Label:	precursor
- UniProtKB:	F7EU44 (UniProtKB/TrEMBL), A6JXC2 (UniProtKB/TrEMBL), A6JXC3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTSSPKAAPGEQGHKEAEMPRAALSPLLLLLLLSWASRDEAAPDQDEIDCLPGLAKQPSFRQYS GYLKASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPY SWNLIANMLYIESPAGVGFSYSDDKMYVTNDTEVAENNYQALKDFYHLFPEYKDNKLFLTGESY AGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCSQ NKCNFYDNKDPDCVNNLQEVSRIVGKSGLNIYNLYAPCAGGVPGRDRSEDTLVVQDFGNIFTRL PLKRRFPEALLLRSGDKVRLDPPCTNTTAPSTYLNNPYVRKALHIPESLPRWDMCNLMVNLQYR RLYESMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGE QVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEPY hide sequence

Ensembl Acc Id:

ENSRNOP00000062425 ⟸ ENSRNOT00000066028

Ensembl Acc Id:

ENSRNOP00000097812 ⟸ ENSRNOT00000105075

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AYS3-F1-model_v2	AlphaFold	Q6AYS3	1-456	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692668

Promoter ID:

EPDNEW_R3193

Type:

initiation region

Name:

Ctsa_1

Description:

cathepsin A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	161,298,913 - 161,298,973	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309070	AgrOrtholog
BioCyc Gene	G2FUF-46822	BioCyc
Ensembl Genes	ENSRNOG00000015857	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000066028.2	UniProtKB/TrEMBL
	ENSRNOT00000105075.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.1820	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7108104	IMAGE-MGC_LOAD
InterPro	AB_hydrolase	UniProtKB/TrEMBL
	Peptidase_S10	UniProtKB/TrEMBL
	Ser_caboxypep_his_AS	UniProtKB/TrEMBL
	Ser_caboxypep_ser_AS	UniProtKB/TrEMBL
KEGG Report	rno:296370	UniProtKB/TrEMBL
MGC_CLONE	MGC:93743	IMAGE-MGC_LOAD
NCBI Gene	296370	ENTREZGENE
PANTHER	LYSOSOMAL PROTECTIVE PROTEIN	UniProtKB/TrEMBL
	PTHR11802	UniProtKB/TrEMBL
Pfam	Peptidase_S10	UniProtKB/TrEMBL
PhenoGen	Ctsa	PhenoGen
PRINTS	CRBOXYPTASEC	UniProtKB/TrEMBL
PROSITE	CARBOXYPEPT_SER_HIS	UniProtKB/TrEMBL
	CARBOXYPEPT_SER_SER	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000015857	RatGTEx
Superfamily-SCOP	SSF53474	UniProtKB/TrEMBL
UniProt	A0A8I6ARV9_RAT	UniProtKB/TrEMBL
	A6JXC2	ENTREZGENE, UniProtKB/TrEMBL
	A6JXC3	ENTREZGENE, UniProtKB/TrEMBL
	F7EU44	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-08-05	Ctsa	cathepsin A	Ppgb	protective protein for beta-galactosidase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Ppgb	protective protein for beta-galactosidase	Ppgb_predicted	protective protein for beta-galactosidase (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Ppgb_predicted	protective protein for beta-galactosidase (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)