Advanced Search (OLGA)

Gene: Rrh (retinal pigment epithelium derived rhodopsin homolog) Rattus norvegicus

Analyze

Symbol:

Rrh

Name:

retinal pigment epithelium derived rhodopsin homolog

RGD ID:

1308948

Description:

Predicted to enable G protein-coupled photoreceptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway; cellular response to light stimulus; and phototransduction. Predicted to be active in plasma membrane. Orthologous to human RRH (retinal pigment epithelium-derived rhodopsin homolog); INTERACTS WITH bisphenol A; copper atom; copper(0).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC310869; visual pigment-like receptor peropsin

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	221,036,436 - 221,048,627 (-)	NCBI		GRCr8
mRatBN7.2	2	218,362,195 - 218,374,387 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	218,362,200 - 218,374,599 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	226,047,228 - 226,059,410 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	223,946,915 - 223,959,097 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	218,804,568 - 218,816,750 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	235,237,422 - 235,250,474 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	235,237,414 - 235,249,575 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	74,673,233 - 74,686,298 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	227,256,627 - 227,266,897 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	227,243,323 - 227,253,557 (-)	NCBI
Celera	2	210,647,417 - 210,659,569 (-)	NCBI		Celera
Cytogenetic Map	2	q43	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

copper atom (EXP)

copper(0) (EXP)

diallyl disulfide (ISO)

methotrexate (ISO)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

nickel atom (ISO)

paracetamol (ISO)

potassium chromate (ISO)

trichostatin A (ISO)

zinc sulfate (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to light stimulus (IBA)

detection of visible light (IEA)

G protein-coupled receptor signaling pathway (IBA)

phototransduction (IBA)

visual perception (IEA)

Cellular Component

plasma membrane (IBA)

Molecular Function

G protein-coupled photoreceptor activity (IBA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Rrh
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	221,036,436 - 221,048,627 (-)	NCBI		GRCr8
mRatBN7.2	2	218,362,195 - 218,374,387 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	218,362,200 - 218,374,599 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	226,047,228 - 226,059,410 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	223,946,915 - 223,959,097 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	218,804,568 - 218,816,750 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	235,237,422 - 235,250,474 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	235,237,414 - 235,249,575 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	74,673,233 - 74,686,298 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	227,256,627 - 227,266,897 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	227,243,323 - 227,253,557 (-)	NCBI
Celera	2	210,647,417 - 210,659,569 (-)	NCBI		Celera
Cytogenetic Map	2	q43	NCBI

RRH
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	109,827,972 - 109,844,942 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	109,827,972 - 109,849,123 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	110,749,128 - 110,766,098 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	110,968,599 - 110,985,312 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	111,106,749 - 111,123,267	NCBI
Celera	4	108,042,720 - 108,059,581 (+)	NCBI		Celera
Cytogenetic Map	4	q25	NCBI
HuRef	4	106,481,266 - 106,497,986 (+)	NCBI		HuRef
CHM1_1	4	110,725,638 - 110,742,332 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	113,130,031 - 113,147,001 (+)	NCBI		T2T-CHM13v2.0

Rrh
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	129,596,837 - 129,618,140 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	129,598,057 - 129,616,236 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	129,808,575 - 129,822,505 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	129,804,408 - 129,822,587 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	129,511,493 - 129,525,423 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	129,796,430 - 129,814,515 (-)	NCBI		MGSCv36	mm8
Celera	3	136,321,461 - 136,335,255 (-)	NCBI		Celera
Cytogenetic Map	3	G3	NCBI
cM Map	3	59.09	NCBI

Rrh
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955496	460,094 - 473,007 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955496	460,094 - 473,007 (-)	NCBI	ChiLan1.0	ChiLan1.0

RRH
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	107,918,799 - 107,937,107 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	108,209,185 - 108,230,780 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	102,322,028 - 102,341,974 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	112,891,370 - 112,909,406 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	112,891,370 - 112,909,398 (+)	Ensembl	panpan1.1		panPan2

RRH
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	32	30,005,920 - 30,027,012 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	32	30,008,312 - 30,024,851 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	32	12,002,978 - 12,024,099 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	32	30,226,694 - 30,247,825 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	32	30,216,948 - 30,245,664 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	32	30,220,961 - 30,242,081 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	32	29,964,046 - 29,985,096 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	32	9,864,018 - 9,885,055 (-)	NCBI		UU_Cfam_GSD_1.0

Rrh
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405301	10,918,509 - 10,934,686 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936563	1,017,401 - 1,035,520 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936563	1,017,272 - 1,032,486 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RRH
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	112,382,189 - 112,399,176 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	112,382,208 - 112,399,622 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	120,465,521 - 120,481,832 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RRH
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	57,724,231 - 57,743,157 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	57,726,055 - 57,742,494 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	36,376,920 - 36,395,581 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rrh
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624830	77,598 - 90,507 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624830	77,889 - 90,507 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rrh
64 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	43
Count of miRNA genes:	41
Interacting mature miRNAs:	43
Transcripts:	ENSRNOT00000013506
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
2301408	Kidm36	Kidney mass QTL 36		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	190613715	226808892	Rat
1598813	Memor9	Memory QTL 9	2.7		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	199341726	234244620	Rat
8693697	Alc36	Alcohol consumption QTL 36	2	0.592	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	2	217139753	236660713	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
1298075	Scl17	Serum cholesterol level QTL 17	3.4		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	211744537	249053267	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
2298479	Eau5	Experimental allergic uveoretinitis QTL 5		0.0021	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	2	202446871	237938339	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
1300126	Bp175	Blood pressure QTL 175	3.46		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	214226044	247136170	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
7207484	Bss108	Bone structure and strength QTL 108	5.3		femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	2	211744537	249053267	Rat
2313073	Bmd75	Bone mineral density QTL 75	4.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	2	215377404	237938339	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	184165752	229165752	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189599258	234599258	Rat
7207482	Bss107	Bone structure and strength QTL 107	7		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	2	211744537	249053267	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	193452645	245889826	Rat
1549836	Bss2	Bone structure and strength QTL 2	7.5		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	2	211744537	249053267	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
2317885	Alcrsp28	Alcohol response QTL 28	2.1	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	212828222	249053267	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	185876309	219753474	Rat
1581499	Esta2	Estrogen-induced thymic atrophy QTL 2			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	189599258	226936289	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	182171407	227171407	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	182171407	227171407	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	179946951	224946951	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
631203	Gluco14	Glucose level QTL 14		0.0001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	2	206665645	219003804	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	182171407	227171407	Rat
1598835	Anxrr18	Anxiety related response QTL 18	2.98		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	2	200990457	245990457	Rat
7207490	Bss111	Bone structure and strength QTL 111	6.4		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	2	211744537	249053267	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1331745	Bp203	Blood pressure QTL 203	4.377		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	189599258	218414891	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	182171407	227171407	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	189599258	234599258	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
2299161	Iddm33	Insulin dependent diabetes mellitus QTL 33	2.98		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	206312063	220876787	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	179335906	224335906	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat

Markers in Region

RH133679

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	218,362,369 - 218,362,550 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	235,237,593 - 235,237,773	NCBI	Rnor6.0
Rnor_5.0	2	74,685,947 - 74,686,127	UniSTS	Rnor5.0
Celera	2	210,647,587 - 210,647,767	UniSTS
RH 3.4 Map	2	1547.1	UniSTS
Cytogenetic Map	2	q43	UniSTS

AW522370

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	218,372,715 - 218,372,848 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	235,247,938 - 235,248,070	NCBI	Rnor6.0
Rnor_5.0	2	74,675,651 - 74,675,783	UniSTS	Rnor5.0
RGSC_v3.4	2	227,265,260 - 227,265,392	UniSTS	RGSC3.4
Celera	2	210,657,932 - 210,658,064	UniSTS
RH 3.4 Map	2	1547.7	UniSTS
Cytogenetic Map	2	q43	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	8	35	112	83	83	53	24	53	6	190	79	93	43	54	30

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107726	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001415060	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590937	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC117142	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000085096 ⟹ ENSRNOP00000072493

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	218,362,200 - 218,374,353 (-)	Ensembl
Rnor_6.0 Ensembl	2	235,237,423 - 235,249,575 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093631 ⟹ ENSRNOP00000076275

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	218,362,200 - 218,374,599 (-)	Ensembl
Rnor_6.0 Ensembl	2	235,237,414 - 235,249,571 (-)	Ensembl

RefSeq Acc Id:

NM_001107726 ⟹ NP_001101196

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	221,036,436 - 221,048,627 (-)	NCBI
mRatBN7.2	2	218,362,195 - 218,374,387 (-)	NCBI
Rnor_6.0	2	235,237,423 - 235,249,575 (-)	NCBI
Rnor_5.0	2	74,673,233 - 74,686,298 (+)	NCBI
RGSC_v3.4	2	227,256,627 - 227,266,897 (-)	RGD
Celera	2	210,647,417 - 210,659,569 (-)	RGD

Sequence:

show sequence

CCAAAGGTGGTCTCTCCAAAATGCTGAGGGACGCTTTGGATTTTAACAGCTCAGGCTCTGGGAG
TGAAGGTTCTGTCTTTACAAAGAGTGAGCACAGCATCATTGCAGCTTACCTGATTGTGGCAGGA
AGAAGAATGACCGGCAACACTTACCTCAGCATGGTCCTGGGCGCCTGGATCAATGGCCTATTTT
GGGCTTTGATGCCCATTGTGGGGTGGGCTAGTTATGCCCCGGATCCTACTGGGGCTACATGTAC
CATAAACTGGCGGAAAAATGATACCTCTTTTGTGTCTTACACCATGATGGTTATTGTGGTGAAC
TTCATCGTGCCCTTGACAGTGATGTTTTACTGTTACTACCACGTCAGTCAGTCCATGAGACTTT
CCGCTGCTAGTAACTGCACTACGCACCTCAACAGAGACTGGGCACACCAGGCCGATGTAACCAA
GATGTCTGTGATGATGATACTGATGTTTTTGCTGGCATGGTCCCCGTATTCTGTTGTGTGCCTA
TGGGCTTGTTTTGGAAACCCGAAAAAGATTCCTCCTTCATTGGCCATCATAGCTCCACTGTTTG
CAAAATCCTCCACGTTCTACAACCCTTGTATTTATGTGGCTGCCAATAAGAAGTTTCGGAAGGC
CATGTTTGCCATGTTGAAGTGCCAACCTCACCAGGCAATGCCTGAGCCAAGCACTCTAGCAATG
GGTGTGCCTCACAGCCCATTGGCTCCTGCAAGGATCTGAAATGCAAGGAAAGAATATACCACCA
AACATTCGATGCGTTTATTTTTTGGCAATACGCTGATTTTGTTTTAAATGTGAATCCATTTAGA
CCAAGCGCTGACATAGACTATTGCCTTGTTGGACTGCAGGCTCCTCCGACACAGCCACCCCAAC
TTGAGCAGCACTGGCTGCAGAGCCTCACTGTGTCCTCAGGATAACTAAGTAGCTACACGTGCTT
CGTTGGATCCAGGCACACGAACTACAGTCTCGCTCTCCTTAAAGGGCGCACATCATAGTACATA
GATGACCTGTAACTTGACTAAGGTTTCCACTAGCCAAGAAACAGCTGTCAGAACACTAGAATAT
TTTAATAAAATTATAATCCTC

hide sequence

RefSeq Acc Id:

NM_001415060 ⟹ NP_001401989

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	221,036,436 - 221,048,627 (-)	NCBI
mRatBN7.2	2	218,362,195 - 218,374,387 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001101196	(Get FASTA)	NCBI Sequence Viewer
	NP_001401989	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL82183	(Get FASTA)	NCBI Sequence Viewer
	EDL82184	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000072493.1
	ENSRNOP00000076275.1

RefSeq Acc Id:	NP_001101196 ⟸ NM_001107726
- Peptide Label:	isoform 2
- UniProtKB:	D3ZY73 (UniProtKB/TrEMBL), A6HVP7 (UniProtKB/TrEMBL), A6HVP8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLRDALDFNSSGSGSEGSVFTKSEHSIIAAYLIVAGRRMTGNTYLSMVLGAWINGLFWALMPIV GWASYAPDPTGATCTINWRKNDTSFVSYTMMVIVVNFIVPLTVMFYCYYHVSQSMRLSAASNCT THLNRDWAHQADVTKMSVMMILMFLLAWSPYSVVCLWACFGNPKKIPPSLAIIAPLFAKSSTFY NPCIYVAANKKFRKAMFAMLKCQPHQAMPEPSTLAMGVPHSPLAPARI hide sequence

Ensembl Acc Id:

ENSRNOP00000072493 ⟸ ENSRNOT00000085096

Ensembl Acc Id:

ENSRNOP00000076275 ⟸ ENSRNOT00000093631

RefSeq Acc Id:	NP_001401989 ⟸ NM_001415060
- Peptide Label:	isoform 1
- UniProtKB:	A0A1W2Q6H2 (UniProtKB/TrEMBL)

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A1W2Q6H2-F1-model_v2	AlphaFold	A0A1W2Q6H2	1-337	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308948	AgrOrtholog
BioCyc Gene	G2FUF-51238	BioCyc
Ensembl Genes	ENSRNOG00000053349	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000085096.2	UniProtKB/TrEMBL
	ENSRNOT00000093631.2	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_opsins	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
	Peropsin	UniProtKB/TrEMBL
	Retinal_BS	UniProtKB/TrEMBL
KEGG Report	rno:310869	UniProtKB/TrEMBL
NCBI Gene	310869	ENTREZGENE
PANTHER	OPSIN	UniProtKB/TrEMBL
	PTHR24240:SF77	UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/TrEMBL
PhenoGen	Rrh	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	PEROPSIN	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
	OPSIN	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000053349	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A0A1W2Q6H2	ENTREZGENE, UniProtKB/TrEMBL
	A6HVP7	ENTREZGENE, UniProtKB/TrEMBL
	A6HVP8	ENTREZGENE, UniProtKB/TrEMBL
	D3ZY73	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Rrh	retinal pigment epithelium derived rhodopsin homolog	Rrh_predicted	retinal pigment epithelium derived rhodopsin homolog (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Rrh_predicted	retinal pigment epithelium derived rhodopsin homolog (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message