Advanced Search (OLGA)

Gene: Meox1 (mesenchyme homeobox 1) Rattus norvegicus

Analyze

Symbol:

Meox1

Name:

mesenchyme homeobox 1

RGD ID:

1308911

Description:

Predicted to enable several functions, including DNA-binding transcription activator activity, RNA polymerase II-specific; HMG box domain binding activity; and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II and sclerotome development. Predicted to act upstream of or within positive regulation of transcription by RNA polymerase II and somite specification. Predicted to be located in cytoplasm. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in Klippel-Feil syndrome 2. Orthologous to human MEOX1 (mesenchyme homeobox 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

homeobox protein MOX-1; LOC363684

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MEOX1 (mesenchyme homeobox 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB
Mus musculus (house mouse):	Meox1 (mesenchyme homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Meox1 (mesenchyme homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MEOX1 (mesenchyme homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MEOX1 (mesenchyme homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Meox1 (mesenchyme homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MEOX1 (mesenchyme homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MEOX1 (mesenchyme homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Meox1 (mesenchyme homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	MEOX1 (mesenchyme homeobox 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Meox1 (mesenchyme homeobox 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	meox1 (mesenchyme homeobox 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	btn	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	87,318,668 - 87,338,169 (-)	NCBI		GRCr8
mRatBN7.2	10	86,818,450 - 86,837,563 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	86,818,478 - 86,837,660 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	91,847,337 - 91,866,465 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	91,322,912 - 91,342,086 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	86,716,213 - 86,735,389 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	89,797,011 - 89,817,009 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	89,797,038 - 89,816,491 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	89,590,582 - 89,609,632 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	90,921,589 - 90,942,298 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	90,937,064 - 91,032,603 (-)	NCBI
Celera	10	85,538,517 - 85,557,370 (-)	NCBI		Celera
Cytogenetic Map	10	q32.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Meox1	Rat	genetic disease		ISO	RGD:1318950	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:25741868\|PMID:28492532
Meox1	Rat	hereditary breast ovarian cancer syndrome		ISO	RGD:1318950	8554872	ClinVar Annotator: match by term: Breast-ovarian cancer, familial, susceptibility to, 1	ClinVar	PMID:38922859
Meox1	Rat	Klippel-Feil syndrome 2		ISO	RGD:1318950	8554872	ClinVar Annotator: match by term: Klippel-Feil syndrome 2, autosomal recessive \| ClinVar Annotator: match by more ...	ClinVar	PMID:23290072\|PMID:24073994\|PMID:25741868\|PMID:28492532

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Meox1	Rat	allergic contact dermatitis		ISO	RGD:1318950	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:16033404
Meox1	Rat	Klippel-Feil syndrome		ISO	RGD:1318950	11554173	CTD Direct Evidence: marker/mechanism	CTD
Meox1	Rat	lung adenocarcinoma		ISO	RGD:1318950	11554173	CTD Direct Evidence: therapeutic	CTD	PMID:34837450
Meox1	Rat	lung non-small cell carcinoma		ISO	RGD:1318950	11554173	CTD Direct Evidence: therapeutic	CTD	PMID:34837450

Imported Disease Annotations - OMIM

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Meox1	Rat	Klippel-Feil syndrome 2		ISO	RGD:1318950	7240710		OMIM

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Meox1	Rat	1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane	decreases expression	ISO	RGD:1318950	6480464	o,p'-DDT results in decreased expression of MEOX1 mRNA	CTD	PMID:19371625
Meox1	Rat	1,2-dichloroethane	decreases expression	ISO	RGD:1318951	6480464	ethylene dichloride results in decreased expression of MEOX1 mRNA	CTD	PMID:28960355
Meox1	Rat	1,2-dimethylhydrazine	increases expression	ISO	RGD:1318951	6480464	1,2-Dimethylhydrazine results in increased expression of MEOX1 mRNA	CTD	PMID:22206623
Meox1	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	RGD:1318951	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MEOX1 mRNA	CTD	PMID:17942748
Meox1	Rat	17alpha-ethynylestradiol	affects expression	ISO	RGD:1318950	6480464	Ethinyl Estradiol affects the expression of MEOX1 mRNA	CTD	PMID:26865667
Meox1	Rat	17beta-estradiol	decreases expression	ISO	RGD:1318950	6480464	Estradiol results in decreased expression of MEOX1 mRNA	CTD	PMID:23019147
Meox1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1318951	6480464	Tetrachlorodibenzodioxin affects the expression of MEOX1 mRNA	CTD	PMID:24058054
Meox1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of MEOX1 mRNA	CTD	PMID:34747641
Meox1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of MEOX1 mRNA	CTD	PMID:32109520
Meox1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1318951	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MEOX1 mRNA	CTD	PMID:17942748
Meox1	Rat	2,4-di-tert-butylphenol	multiple interactions	ISO	RGD:1318950	6480464	[Chir 99021 co-treated with 2,4-di-tert-butylphenol] results in decreased expression of MEOX1 mRNA	CTD	PMID:36682590
Meox1	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	RGD:1318951	6480464	bisphenol S affects the methylation of MEOX1 gene	CTD	PMID:31683443
Meox1	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:1318951	6480464	Fenretinide results in increased expression of MEOX1 mRNA	CTD	PMID:28973697
Meox1	Rat	5-fluorouracil	increases expression	ISO	RGD:1318950	6480464	Fluorouracil results in increased expression of MEOX1 mRNA	CTD	PMID:31711903
Meox1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of MEOX1 mRNA	CTD	PMID:30047161
Meox1	Rat	8'-apo-beta,psi-caroten-8'-al	increases expression	ISO	RGD:1318950	6480464	apocarotenal results in increased expression of MEOX1 mRNA	CTD	PMID:17034753
Meox1	Rat	9-cis-retinoic acid	increases expression	ISO	RGD:1318950	6480464	Alitretinoin results in increased expression of MEOX1 mRNA	CTD	PMID:17034753
Meox1	Rat	abacavir	decreases expression	ISO	RGD:1318950	6480464	abacavir results in decreased expression of MEOX1 mRNA	CTD	PMID:31711903
Meox1	Rat	aflatoxin B1	increases methylation	ISO	RGD:1318950	6480464	Aflatoxin B1 results in increased methylation of MEOX1 intron	CTD	PMID:30157460
Meox1	Rat	all-trans-4-oxoretinoic acid	increases expression	ISO	RGD:1318950	6480464	4-oxoretinoic acid results in increased expression of MEOX1 mRNA	CTD	PMID:17034753
Meox1	Rat	all-trans-4-oxoretinol	increases expression	ISO	RGD:1318950	6480464	4-oxoretinol results in increased expression of MEOX1 mRNA	CTD	PMID:17034753
Meox1	Rat	all-trans-retinoic acid	increases expression	ISO	RGD:1318950	6480464	Tretinoin results in increased expression of MEOX1 mRNA	CTD	PMID:17034753\|PMID:21934132
Meox1	Rat	all-trans-retinoic acid	decreases expression	ISO	RGD:1318950	6480464	Tretinoin results in decreased expression of MEOX1 mRNA	CTD	PMID:31711903
Meox1	Rat	all-trans-retinoic acid	multiple interactions	ISO	RGD:1318950	6480464	Tretinoin inhibits the reaction [[Chir 99021 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MEOX1 more ...	CTD	PMID:31711903
Meox1	Rat	all-trans-retinol	increases expression	ISO	RGD:1318950	6480464	Vitamin A results in increased expression of MEOX1 mRNA	CTD	PMID:17034753
Meox1	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of MEOX1 mRNA	CTD	PMID:30047161
Meox1	Rat	arsenous acid	decreases expression	ISO	RGD:1318950	6480464	Arsenic Trioxide results in decreased expression of MEOX1 mRNA	CTD	PMID:26705709
Meox1	Rat	belinostat	increases expression	ISO	RGD:1318950	6480464	belinostat results in increased expression of MEOX1 mRNA	CTD	PMID:26272509
Meox1	Rat	belinostat	multiple interactions	ISO	RGD:1318950	6480464	[NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Meox1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1318951	6480464	Benzo(a)pyrene results in decreased expression of MEOX1 mRNA	CTD	PMID:21569818
Meox1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1318950	6480464	Benzo(a)pyrene results in decreased expression of MEOX1 mRNA	CTD	PMID:30659931
Meox1	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1318950	6480464	Benzo(a)pyrene affects the methylation of MEOX1 promoter	CTD	PMID:27901495
Meox1	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1318950	6480464	Benzo(a)pyrene results in increased methylation of MEOX1 exon	CTD	PMID:27901495
Meox1	Rat	benzo[b]fluoranthene	decreases expression	ISO	RGD:1318951	6480464	benzo(b)fluoranthene results in decreased expression of MEOX1 mRNA	CTD	PMID:26377693
Meox1	Rat	benzo[e]pyrene	increases methylation	ISO	RGD:1318950	6480464	benzo(e)pyrene results in increased methylation of MEOX1 intron	CTD	PMID:30157460
Meox1	Rat	beta-carotene	increases expression	ISO	RGD:1318950	6480464	beta Carotene results in increased expression of MEOX1 mRNA	CTD	PMID:17034753
Meox1	Rat	bisphenol A	decreases expression	ISO	RGD:1318950	6480464	bisphenol A results in decreased expression of MEOX1 mRNA	CTD	PMID:19371625\|PMID:34831106
Meox1	Rat	bisphenol A	increases expression	ISO	RGD:1318951	6480464	bisphenol A results in increased expression of MEOX1 mRNA	CTD	PMID:32156529
Meox1	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of MEOX1 gene	CTD	PMID:28505145
Meox1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of MEOX1 mRNA	CTD	PMID:25181051\|PMID:34947998
Meox1	Rat	bisphenol A	affects expression	ISO	RGD:1318950	6480464	bisphenol A affects the expression of MEOX1 mRNA	CTD	PMID:20170705
Meox1	Rat	bisphenol F	decreases expression	ISO	RGD:1318950	6480464	bisphenol F results in decreased expression of MEOX1 mRNA	CTD	PMID:34831106
Meox1	Rat	butylated hydroxyanisole	decreases expression	ISO	RGD:1318951	6480464	Butylated Hydroxyanisole results in decreased expression of MEOX1 mRNA	CTD	PMID:28927898
Meox1	Rat	cadmium dichloride	increases expression	ISO	RGD:1318950	6480464	Cadmium Chloride results in increased expression of MEOX1 mRNA	CTD	PMID:38568856
Meox1	Rat	carbamazepine	affects expression	ISO	RGD:1318950	6480464	Carbamazepine affects the expression of MEOX1 mRNA	CTD	PMID:25979313
Meox1	Rat	CGP 52608	multiple interactions	ISO	RGD:1318950	6480464	CGP 52608 promotes the reaction [RORA protein binds to MEOX1 gene]	CTD	PMID:28238834
Meox1	Rat	CHIR 99021	multiple interactions	ISO	RGD:1318950	6480464	[Chir 99021 co-treated with 2,4-di-tert-butylphenol] results in decreased expression of MEOX1 mRNA; [Chir 99021 co-treated more ...	CTD	PMID:31711903\|PMID:36682590
Meox1	Rat	chlorpyrifos	decreases expression	ISO	RGD:1318951	6480464	Chlorpyrifos results in decreased expression of MEOX1 mRNA	CTD	PMID:32715474
Meox1	Rat	choline	multiple interactions	ISO	RGD:1318951	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Meox1	Rat	copper atom	increases expression	EXP		6480464	Copper deficiency results in increased expression of MEOX1 mRNA	CTD	PMID:26033743
Meox1	Rat	copper(0)	increases expression	EXP		6480464	Copper deficiency results in increased expression of MEOX1 mRNA	CTD	PMID:26033743
Meox1	Rat	copper(II) sulfate	decreases expression	ISO	RGD:1318950	6480464	Copper Sulfate results in decreased expression of MEOX1 mRNA	CTD	PMID:19549813
Meox1	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of MEOX1 mRNA	CTD	PMID:26577399
Meox1	Rat	dabigatran	decreases expression	ISO	RGD:1318950	6480464	Dabigatran results in decreased expression of MEOX1 mRNA	CTD	PMID:31711903
Meox1	Rat	diarsenic trioxide	decreases expression	ISO	RGD:1318950	6480464	Arsenic Trioxide results in decreased expression of MEOX1 mRNA	CTD	PMID:26705709
Meox1	Rat	dibutyl phthalate	increases expression	ISO	RGD:1318951	6480464	Dibutyl Phthalate results in increased expression of MEOX1 mRNA	CTD	PMID:17361019\|PMID:21266533
Meox1	Rat	diethylstilbestrol	decreases expression	ISO	RGD:1318950	6480464	Diethylstilbestrol results in decreased expression of MEOX1 mRNA	CTD	PMID:19371625
Meox1	Rat	dolutegravir	decreases expression	ISO	RGD:1318951	6480464	dolutegravir results in decreased expression of MEOX1 mRNA	CTD	PMID:34515794
Meox1	Rat	dorsomorphin	multiple interactions	ISO	RGD:1318950	6480464	[NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Meox1	Rat	doxorubicin	decreases expression	ISO	RGD:1318950	6480464	Doxorubicin results in decreased expression of MEOX1 mRNA	CTD	PMID:29803840
Meox1	Rat	doxorubicin	increases expression	ISO	RGD:1318951	6480464	Doxorubicin results in increased expression of MEOX1 mRNA	CTD	PMID:36227756
Meox1	Rat	Doxylamine succinate	decreases expression	ISO	RGD:1318950	6480464	doxylamine succinate results in decreased expression of MEOX1 mRNA	CTD	PMID:31711903
Meox1	Rat	entinostat	increases expression	ISO	RGD:1318950	6480464	entinostat results in increased expression of MEOX1 mRNA	CTD	PMID:26272509
Meox1	Rat	entinostat	multiple interactions	ISO	RGD:1318950	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Meox1	Rat	ethylene glycol	decreases expression	ISO	RGD:1318950	6480464	Ethylene Glycol results in decreased expression of MEOX1 mRNA	CTD	PMID:31711903
Meox1	Rat	fluoxetine	affects expression	ISO	RGD:1318951	6480464	Fluoxetine affects the expression of MEOX1 mRNA	CTD	PMID:29893963
Meox1	Rat	folic acid	multiple interactions	ISO	RGD:1318951	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Meox1	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of MEOX1 mRNA	CTD	PMID:27387713
Meox1	Rat	genistein	decreases expression	ISO	RGD:1318950	6480464	Genistein results in decreased expression of MEOX1 mRNA	CTD	PMID:19371625\|PMID:26865667
Meox1	Rat	glyphosate	increases methylation	EXP		6480464	Glyphosate results in increased methylation of MEOX1 gene	CTD	PMID:31011160
Meox1	Rat	GW 4064	increases expression	ISO	RGD:1318951	6480464	GW 4064 results in increased expression of MEOX1 mRNA	CTD	PMID:26655953
Meox1	Rat	inulin	multiple interactions	ISO	RGD:1318951	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of MEOX1 mRNA	CTD	PMID:36331819
Meox1	Rat	isotretinoin	decreases expression	ISO	RGD:1318950	6480464	Isotretinoin results in decreased expression of MEOX1 mRNA	CTD	PMID:31711903
Meox1	Rat	L-methionine	multiple interactions	ISO	RGD:1318951	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Meox1	Rat	Licochalcone B	decreases expression	ISO	RGD:1318950	6480464	licochalcone B results in decreased expression of MEOX1 mRNA	CTD	PMID:33647349
Meox1	Rat	lidocaine	decreases expression	EXP		6480464	Lidocaine results in decreased expression of MEOX1 mRNA	CTD	PMID:35283115
Meox1	Rat	mercury dibromide	increases expression	ISO	RGD:1318950	6480464	mercuric bromide results in increased expression of MEOX1 mRNA	CTD	PMID:26272509
Meox1	Rat	mercury dibromide	multiple interactions	ISO	RGD:1318950	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Meox1	Rat	methapyrilene	increases methylation	ISO	RGD:1318950	6480464	Methapyrilene results in increased methylation of MEOX1 intron	CTD	PMID:30157460
Meox1	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of MEOX1 mRNA	CTD	PMID:30047161
Meox1	Rat	methoxyacetic acid	decreases expression	ISO	RGD:1318951	6480464	methoxyacetic acid results in decreased expression of MEOX1 mRNA	CTD	PMID:32496642
Meox1	Rat	methyl methanesulfonate	decreases expression	ISO	RGD:1318950	6480464	Methyl Methanesulfonate results in decreased expression of MEOX1 mRNA	CTD	PMID:23649840
Meox1	Rat	methylmercury chloride	increases expression	ISO	RGD:1318950	6480464	methylmercuric chloride results in increased expression of MEOX1 mRNA	CTD	PMID:28001369
Meox1	Rat	methylparaben	decreases expression	ISO	RGD:1318951	6480464	methylparaben results in decreased expression of MEOX1 mRNA	CTD	PMID:28927898
Meox1	Rat	mono(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1318950	6480464	mono-(2-ethylhexyl)phthalate results in increased expression of MEOX1 mRNA	CTD	PMID:31711903
Meox1	Rat	nilotinib	decreases expression	ISO	RGD:1318950	6480464	nilotinib results in decreased expression of MEOX1 mRNA	CTD	PMID:31711903
Meox1	Rat	nitrofen	decreases expression	EXP		6480464	nitrofen results in decreased expression of MEOX1 mRNA	CTD	PMID:33484710
Meox1	Rat	ozone	multiple interactions	ISO	RGD:1318951	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ...	CTD	PMID:34911549
Meox1	Rat	p-chloromercuribenzoic acid	increases expression	ISO	RGD:1318950	6480464	p-Chloromercuribenzoic Acid results in increased expression of MEOX1 mRNA	CTD	PMID:26272509
Meox1	Rat	p-chloromercuribenzoic acid	multiple interactions	ISO	RGD:1318950	6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Meox1	Rat	panobinostat	multiple interactions	ISO	RGD:1318950	6480464	[NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Meox1	Rat	panobinostat	increases expression	ISO	RGD:1318950	6480464	panobinostat results in increased expression of MEOX1 mRNA	CTD	PMID:26272509
Meox1	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:1318951	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of MEOX1 mRNA	CTD	PMID:36331819
Meox1	Rat	phenylmercury acetate	increases expression	ISO	RGD:1318950	6480464	Phenylmercuric Acetate results in increased expression of MEOX1 mRNA	CTD	PMID:26272509
Meox1	Rat	phenylmercury acetate	multiple interactions	ISO	RGD:1318950	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Meox1	Rat	phenytoin	decreases expression	ISO	RGD:1318950	6480464	Phenytoin results in decreased expression of MEOX1 mRNA	CTD	PMID:31711903
Meox1	Rat	pregnenolone 16alpha-carbonitrile	increases expression	EXP		6480464	Pregnenolone Carbonitrile results in increased expression of MEOX1 mRNA	CTD	PMID:30047161
Meox1	Rat	resveratrol	multiple interactions	ISO	RGD:1318950	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of MEOX1 mRNA	CTD	PMID:23557933
Meox1	Rat	SB 431542	multiple interactions	ISO	RGD:1318950	6480464	[Chir 99021 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MEOX1 mRNA; [NOG protein co-treated more ...	CTD	PMID:27188386\|PMID:31711903
Meox1	Rat	sodium arsenite	decreases expression	ISO	RGD:1318951	6480464	sodium arsenite results in decreased expression of MEOX1 mRNA	CTD	PMID:37682722
Meox1	Rat	sodium dodecyl sulfate	increases expression	ISO	RGD:1318950	6480464	Sodium Dodecyl Sulfate results in increased expression of MEOX1 mRNA	CTD	PMID:31734321
Meox1	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of MEOX1 mRNA	CTD	PMID:30047161
Meox1	Rat	sulforaphane	decreases expression	ISO	RGD:1318950	6480464	sulforaphane results in decreased expression of MEOX1 mRNA	CTD	PMID:31838189
Meox1	Rat	thalidomide	decreases expression	ISO	RGD:1318950	6480464	Thalidomide results in decreased expression of MEOX1 mRNA	CTD	PMID:31711903
Meox1	Rat	titanium dioxide	increases expression	ISO	RGD:1318951	6480464	titanium dioxide results in increased expression of MEOX1 mRNA	CTD	PMID:23557971
Meox1	Rat	tributylstannane	increases expression	EXP		6480464	tributyltin results in increased expression of MEOX1 mRNA	CTD	PMID:31129395
Meox1	Rat	trichostatin A	increases expression	ISO	RGD:1318950	6480464	trichostatin A results in increased expression of MEOX1 mRNA	CTD	PMID:24935251\|PMID:26272509
Meox1	Rat	trichostatin A	multiple interactions	ISO	RGD:1318950	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Meox1	Rat	triclosan	increases expression	ISO	RGD:1318950	6480464	Triclosan results in increased expression of MEOX1 mRNA	CTD	PMID:30510588
Meox1	Rat	valproic acid	increases methylation	ISO	RGD:1318950	6480464	Valproic Acid results in increased methylation of MEOX1 gene	CTD	PMID:29154799
Meox1	Rat	valproic acid	decreases expression	ISO	RGD:1318950	6480464	Valproic Acid results in decreased expression of MEOX1 mRNA	CTD	PMID:28001369\|PMID:31711903
Meox1	Rat	valproic acid	multiple interactions	ISO	RGD:1318950	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Meox1	Rat	valproic acid	increases expression	ISO	RGD:1318950	6480464	Valproic Acid results in increased expression of MEOX1 mRNA	CTD	PMID:23179753\|PMID:24383497\|PMID:24935251\|PMID:26272509
Meox1	Rat	valproic acid	decreases expression	ISO	RGD:1318951	6480464	Valproic Acid results in decreased expression of MEOX1 mRNA	CTD	PMID:27693483
Meox1	Rat	valproic acid	multiple interactions	ISO	RGD:1318951	6480464	4-(2-(5,6-dihydro-5,5-dimethyl-8-(2-phenylethynyl)naphthalen-2-yl)ethen-1-yl)benzoic acid inhibits the reaction [Valproic Acid results in decreased expression of MEOX1 mRNA]	CTD	PMID:27693483
Meox1	Rat	valproic acid	affects expression	ISO	RGD:1318950	6480464	Valproic Acid affects the expression of MEOX1 mRNA	CTD	PMID:25979313
Meox1	Rat	vorinostat	multiple interactions	ISO	RGD:1318950	6480464	[NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Meox1	Rat	vorinostat	increases expression	ISO	RGD:1318950	6480464	vorinostat results in increased expression of MEOX1 mRNA	CTD	PMID:26272509
Meox1	Rat	zearalenone	decreases expression	ISO	RGD:1318950	6480464	Zearalenone results in decreased expression of MEOX1 mRNA	CTD	PMID:19371625

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Meox1	Rat	positive regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	ISO	RGD:1318951	1624291	MGI:97485\|MGI:97493 PMID:15024065	RGD	PMID:15024065
Meox1	Rat	positive regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	IEA	UniProtKB:P32442\|ensembl:ENSMUSP00000051158	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Meox1	Rat	positive regulation of transcription by RNA polymerase II	involved_in	IEA	InterPro:IPR042634	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Meox1	Rat	positive regulation of transcription by RNA polymerase II	involved_in	ISO	RGD:1318951	1624291	PMID:15024065	RGD	PMID:15024065
Meox1	Rat	regulation of DNA-templated transcription	involved_in	IEA	InterPro:IPR017970	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Meox1	Rat	regulation of transcription by RNA polymerase II	involved_in	IBA	MGI:103220\|PANTHER:PTN001216052\|UniProtKB:P50222	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Meox1	Rat	sclerotome development	involved_in	ISO	RGD:1318951	1624291	PMID:15024065, PMID:19520072	RGD	PMID:15024065\|PMID:19520072
Meox1	Rat	sclerotome development	involved_in	IEA	UniProtKB:P32442\|ensembl:ENSMUSP00000051158	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Meox1	Rat	somite development	involved_in	ISO	RGD:1318951	1624291	PMID:19520072	RGD	PMID:19520072
Meox1	Rat	somite development	involved_in	IBA	MGI:103219\|MGI:103220\|PANTHER:PTN000675987\|ZFIN:ZDB-GENE-040718-149	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Meox1	Rat	somite development	involved_in	IEA	UniProtKB:P32442\|ensembl:ENSMUSP00000051158	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Meox1	Rat	somite specification	acts_upstream_of_or_within	IEA	UniProtKB:P32442\|ensembl:ENSMUSP00000051158	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Meox1	Rat	somite specification	acts_upstream_of_or_within	ISO	RGD:1318951	1624291	MGI:103219 PMID:12925591	RGD	PMID:12925591

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Meox1	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Meox1	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Meox1	Rat	cytoplasm	located_in	ISO	RGD:1318951	1624291	PMID:22206000	RGD	PMID:22206000
Meox1	Rat	cytoplasm	located_in	IEA	UniProtKB:P32442\|ensembl:ENSMUSP00000051158	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Meox1	Rat	nucleus	located_in	IEA	UniProtKB:P32442\|ensembl:ENSMUSP00000051158	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Meox1	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Meox1	Rat	nucleus	located_in	ISO	RGD:1318951	1624291	PMID:22206000	RGD	PMID:22206000
Meox1	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Meox1	Rat	nucleus	located_in	IEA	UniRule:UR000401037	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Meox1	Rat	nucleus	is_active_in	IBA	MGI:103220\|PANTHER:PTN001216052\|UniProtKB:P50222\|ZFIN:ZDB-GENE-040718-149	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Meox1	Rat	chromatin binding	enables	ISO	RGD:1318951	1624291	PMID:15024065	RGD	PMID:15024065
Meox1	Rat	chromatin binding	enables	IEA	UniProtKB:P32442\|ensembl:ENSMUSP00000051158	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Meox1	Rat	DNA binding	enables	IEA	UniProtKB-KW:KW-0238\|UniProtKB-KW:KW-0371	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Meox1	Rat	DNA binding	enables	IEA	UniRule:UR000401037	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Meox1	Rat	DNA binding	enables	IEA	InterPro:IPR001356\|InterPro:IPR020479	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Meox1	Rat	DNA-binding transcription activator activity, RNA polymerase II-specific	enables	ISO	RGD:1318951	1624291	PMID:15024065	RGD	PMID:15024065
Meox1	Rat	DNA-binding transcription activator activity, RNA polymerase II-specific	enables	IEA	UniProtKB:P32442\|ensembl:ENSMUSP00000051158	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Meox1	Rat	DNA-binding transcription factor activity	enables	IEA	UniProtKB:P32442\|ensembl:ENSMUSP00000051158	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Meox1	Rat	DNA-binding transcription factor activity	enables	ISO	RGD:1318951	1624291	PMID:15024065, PMID:22206000	RGD	PMID:15024065\|PMID:22206000
Meox1	Rat	DNA-binding transcription factor activity	enables	IEA	InterPro:IPR042634	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Meox1	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IBA	MGI:103220\|PANTHER:PTN001216052\|UniProtKB:P50222	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Meox1	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IEA	InterPro:IPR017970	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Meox1	Rat	HMG box domain binding	enables	IEA	UniProtKB:P32442\|ensembl:ENSMUSP00000051158	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Meox1	Rat	HMG box domain binding	enables	ISO	RGD:1318951	1624291	UniProtKB:O55170 PMID:16582099	RGD	PMID:16582099
Meox1	Rat	protein binding	enables	ISO	RGD:1318950	1624291	UniProtKB:A0A0S2Z5G4\|UniProtKB:A0A384ME25\|UniProtKB:B4DE54\|UniProtKB:G5E9A7\|UniProtKB:K7EM05\|UniProtKB:O00560\|UniProtKB:O14893\|UniProtKB:O15344\|UniProtKB:O15347\|UniProtKB:O43247-2\|UniProtKB:O43602\|UniProtKB:O43602-2\|UniProtKB:O76071\|UniProtKB:O94888\|UniProtKB:O95872\|UniProtKB:O95983-2\|UniProtKB:P09917\|UniProtKB:P13807\|UniProtKB:P31273\|UniProtKB:P38919\|UniProtKB:P40222\|UniProtKB:P42858\|UniProtKB:P43351\|UniProtKB:P45984\|UniProtKB:P49427\|UniProtKB:P50402\|UniProtKB:P51452\|UniProtKB:P52756\|UniProtKB:P54284\|UniProtKB:P54619\|UniProtKB:P61024\|UniProtKB:P68400\|UniProtKB:Q02078-2\|UniProtKB:Q08493-2\|UniProtKB:Q12982\|UniProtKB:Q13064\|UniProtKB:Q13526\|UniProtKB:Q13541\|UniProtKB:Q13895\|UniProtKB:Q14CS0\|UniProtKB:Q15642-2\|UniProtKB:Q15735\|UniProtKB:Q2TAL8\|UniProtKB:Q2TBE0\|UniProtKB:Q53TS8\|UniProtKB:Q5JUK9\|UniProtKB:Q63ZY3\|UniProtKB:Q68D86\|UniProtKB:Q6IPC0\|UniProtKB:Q6NT76\|UniProtKB:Q712K3\|UniProtKB:Q7Z3C6-3\|UniProtKB:Q7Z412\|UniProtKB:Q7Z699\|UniProtKB:Q86VK4-3\|UniProtKB:Q8IVA1\|UniProtKB:Q8IW40\|UniProtKB:Q8IXS8\|UniProtKB:Q8IYS1\|UniProtKB:Q8N5J4\|UniProtKB:Q8N7C3\|UniProtKB:Q8N8B7\|UniProtKB:Q8N9N5-2\|UniProtKB:Q8N9N5-7\|UniProtKB:Q8TBK6\|UniProtKB:Q8WV44\|UniProtKB:Q8WYK0\|UniProtKB:Q92870-2\|UniProtKB:Q969R5\|UniProtKB:Q969S2\|UniProtKB:Q96CN9\|UniProtKB:Q96EZ8\|UniProtKB:Q96IZ5\|UniProtKB:Q96MP8-2\|UniProtKB:Q96Q77\|UniProtKB:Q99932-2\|UniProtKB:Q9BRC7\|UniProtKB:Q9BSW7\|UniProtKB:Q9BT43\|UniProtKB:Q9BV19\|UniProtKB:Q9H3U1\|UniProtKB:Q9HAT8\|UniProtKB:Q9HBI0\|UniProtKB:Q9NSC5\|UniProtKB:Q9NUJ3\|UniProtKB:Q9NWQ9\|UniProtKB:Q9NX01\|UniProtKB:Q9NX04\|UniProtKB:Q9UBU8\|UniProtKB:Q9UDX3\|UniProtKB:Q9UH92-3\|UniProtKB:Q9UHB4\|UniProtKB:Q9UJ70\|UniProtKB:Q9UJV3-2\|UniProtKB:Q9UJX0\|UniProtKB:Q9UJX6\|UniProtKB:Q9UKG1\|UniProtKB:Q9UKZ1\|UniProtKB:Q9UL33-2 PMID:23275563, PMID:25416956, PMID:25910212, PMID:26871637, PMID:31515488, PMID:32296183, PMID:32814053	RGD	PMID:23275563\|PMID:25416956\|PMID:25910212\|PMID:26871637\|PMID:31515488\|PMID:32296183\|PMID:32814053
Meox1	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IBA	MGI:103220\|PANTHER:PTN001216052\|UniProtKB:P50222	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Meox1	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IEA	UniProtKB:P32442\|ensembl:ENSMUSP00000051158	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Meox1	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	ISO	RGD:1318951	1624291	PMID:15024065, PMID:19520072	RGD	PMID:15024065\|PMID:19520072
Meox1	Rat	sequence-specific DNA binding	enables	IEA	UniProtKB:P32442\|ensembl:ENSMUSP00000051158	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Meox1	Rat	sequence-specific DNA binding	enables	ISO	RGD:1318951	1624291	PMID:22206000	RGD	PMID:22206000
Meox1	Rat	sequence-specific double-stranded DNA binding	enables	ISO	RGD:1318950	1624291	PMID:28473536	RGD	PMID:28473536
Meox1	Rat	sequence-specific double-stranded DNA binding	enables	IEA	UniProtKB:P50221\|ensembl:ENSP00000321684	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Disease Annotations Click to see Annotation Detail View

allergic contact dermatitis (ISO)

genetic disease (ISO)

hereditary breast ovarian cancer syndrome (ISO)

Klippel-Feil syndrome (ISO)

Klippel-Feil syndrome 2 (ISO)

lung adenocarcinoma (ISO)

lung non-small cell carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-di-tert-butylphenol (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

8'-apo-beta,psi-caroten-8'-al (ISO)

9-cis-retinoic acid (ISO)

abacavir (ISO)

aflatoxin B1 (ISO)

all-trans-4-oxoretinoic acid (ISO)

all-trans-4-oxoretinol (ISO)

all-trans-retinoic acid (ISO)

all-trans-retinol (ISO)

amitrole (EXP)

arsenous acid (ISO)

belinostat (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

benzo[e]pyrene (ISO)

beta-carotene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butylated hydroxyanisole (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

CGP 52608 (ISO)

CHIR 99021 (ISO)

chlorpyrifos (ISO)

choline (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

Cuprizon (EXP)

dabigatran (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

diethylstilbestrol (ISO)

dolutegravir (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

Doxylamine succinate (ISO)

entinostat (ISO)

ethylene glycol (ISO)

fluoxetine (ISO)

folic acid (ISO)

furan (EXP)

genistein (ISO)

glyphosate (EXP)

GW 4064 (ISO)

inulin (ISO)

isotretinoin (ISO)

L-methionine (ISO)

Licochalcone B (ISO)

lidocaine (EXP)

mercury dibromide (ISO)

methapyrilene (ISO)

methimazole (EXP)

methoxyacetic acid (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

methylparaben (ISO)

mono(2-ethylhexyl) phthalate (ISO)

nilotinib (ISO)

nitrofen (EXP)

ozone (ISO)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylmercury acetate (ISO)

phenytoin (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

resveratrol (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sodium dodecyl sulfate (ISO)

sulfadimethoxine (EXP)

sulforaphane (ISO)

thalidomide (ISO)

titanium dioxide (ISO)

tributylstannane (EXP)

trichostatin A (ISO)

triclosan (ISO)

valproic acid (ISO)

vorinostat (ISO)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive regulation of transcription by RNA polymerase II (IEA,ISO)

regulation of DNA-templated transcription (IEA)

regulation of transcription by RNA polymerase II (IBA)

sclerotome development (IEA,ISO)

somite development (IBA,IEA,ISO)

somite specification (IEA,ISO)

Cellular Component

cytoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO)

Molecular Function

chromatin binding (IEA,ISO)

DNA binding (IEA)

DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO)

DNA-binding transcription factor activity (IEA,ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA)

HMG box domain binding (IEA,ISO)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO)

sequence-specific DNA binding (IEA,ISO)

sequence-specific double-stranded DNA binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12925591	PMID:15024065	PMID:16582099	PMID:19520072	PMID:22206000	PMID:29113690	PMID:34233723

Genomics

Comparative Map Data

Meox1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	87,318,668 - 87,338,169 (-)	NCBI		GRCr8
mRatBN7.2	10	86,818,450 - 86,837,563 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	86,818,478 - 86,837,660 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	91,847,337 - 91,866,465 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	91,322,912 - 91,342,086 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	86,716,213 - 86,735,389 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	89,797,011 - 89,817,009 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	89,797,038 - 89,816,491 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	89,590,582 - 89,609,632 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	90,921,589 - 90,942,298 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	90,937,064 - 91,032,603 (-)	NCBI
Celera	10	85,538,517 - 85,557,370 (-)	NCBI		Celera
Cytogenetic Map	10	q32.1	NCBI

MEOX1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	43,640,389 - 43,661,922 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	43,640,389 - 43,661,922 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	41,717,757 - 41,739,290 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	39,073,283 - 39,094,788 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	39,073,285 - 39,094,457	NCBI
Celera	17	38,425,737 - 38,447,247 (-)	NCBI		Celera
Cytogenetic Map	17	q21.31	NCBI
HuRef	17	37,482,058 - 37,503,546 (-)	NCBI		HuRef
CHM1_1	17	41,953,427 - 41,974,933 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	44,492,923 - 44,514,459 (-)	NCBI		T2T-CHM13v2.0

Meox1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	101,768,336 - 101,785,309 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	101,768,336 - 101,785,200 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	101,877,510 - 101,894,354 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	101,877,510 - 101,894,374 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	101,738,824 - 101,755,668 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	101,693,600 - 101,710,444 (-)	NCBI		MGSCv36	mm8
Celera	11	113,579,104 - 113,597,142 (-)	NCBI		Celera
Cytogenetic Map	11	D	NCBI
cM Map	11	65.48	NCBI

Meox1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955451	17,012,982 - 17,022,186 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955451	17,013,180 - 17,022,131 (-)	NCBI	ChiLan1.0	ChiLan1.0

MEOX1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	21,245,821 - 21,267,271 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	23,210,507 - 23,233,067 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	13,733,235 - 13,756,584 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	13,982,668 - 14,003,820 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	13,982,668 - 14,003,820 (+)	Ensembl	panpan1.1		panPan2

MEOX1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	19,614,568 - 19,641,426 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	19,614,503 - 19,640,908 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	19,008,862 - 19,030,248 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	20,314,935 - 20,336,327 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	20,309,565 - 20,335,856 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	19,167,703 - 19,189,081 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	19,350,611 - 19,371,980 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	19,496,073 - 19,517,460 (+)	NCBI		UU_Cfam_GSD_1.0

Meox1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	18,956,445 - 18,978,036 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936541	217,193 - 236,031 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936541	216,390 - 238,153 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MEOX1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	19,431,420 - 19,451,993 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	19,431,397 - 19,452,430 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	19,664,809 - 19,683,972 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MEOX1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	62,747,031 - 62,770,711 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	62,748,671 - 62,770,706 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	33,514,931 - 33,537,124 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Meox1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624795	1,032,546 - 1,040,007 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624795	1,032,278 - 1,041,635 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Meox1
135 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	143
Count of miRNA genes:	96
Interacting mature miRNAs:	117
Transcripts:	ENSRNOT00000028220
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
631555	Bp134	Blood pressure QTL 134		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	80515287	91230079	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	57576521	102576521	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	53797494	98952626	Rat
4889948	Bss91	Bone structure and strength QTL 91	4		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	10	82564856	92369470	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	72224939	107211142	Rat
1579919	Bp281	Blood pressure QTL 281		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	74372084	94965338	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76452683	107211142	Rat
1300107	Rf18	Renal function QTL 18	3.41		urine output (VT:0003620)	timed urine volume (CMO:0000260)	10	78775516	98279596	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	82685200	107211142	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
10450495	Bp383	Blood pressure QTL 383		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	94965338	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2292617	Ept18	Estrogen-induced pituitary tumorigenesis QTL 18	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73453136	96120911	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2293646	Bss25	Bone structure and strength QTL 25	10.96	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	10	69738412	107211142	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
2300172	Bmd57	Bone mineral density QTL 57	9.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	10	69738412	107211142	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72224939	107211142	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
1357344	Bp249	Blood pressure QTL 249		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	66743655	98003205	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
2306970	Anxrr22	Anxiety related response QTL 22	5.95		fear/anxiety-related behavior trait (VT:1000241)	number of periods of voluntary immobility (CMO:0001045)	10	61345276	98211570	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
2293663	Bss33	Bone structure and strength QTL 33	9.34	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	10	69738412	107211142	Rat
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	64890616	107211142	Rat
2312672	Insul15	Insulin level QTL 15		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	10	57134272	102134272	Rat
6893357	Bw102	Body weight QTL 102	0.5	0.36	body mass (VT:0001259)	body weight (CMO:0000012)	10	80515287	101325465	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	66978955	107211142	Rat
2303589	Bw87	Body weight QTL 87	2		body mass (VT:0001259)	body weight (CMO:0000012)	10	81285008	107211142	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
2306793	Ean5	Experimental allergic neuritis QTL 5	4.7		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	72552416	93995749	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
2306792	Ean4	Experimental allergic neuritis QTL 4	4		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	84022321	93995963	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	66978955	107211142	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68420376	107211142	Rat
1358915	Stresp7	Stress response QTL 7	3.52		blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	78899655	87307728	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
10450498	Bp384	Blood pressure QTL 384		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	67750049	107211142	Rat
4889492	Pancm2	Pancreatic morphology QTL 2	3.2		pancreatic beta cell morphology trait (VT:0005217)	ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814)	10	76748906	107211142	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70199100	107211142	Rat
2293698	Bss43	Bone structure and strength QTL 43	5.33	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	10	59209888	104209888	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	54809292	99809292	Rat
1558643	Cm44	Cardiac mass QTL 44	4.8	0.0000368	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	61345276	99703528	Rat
631535	Cm51	Cardiac mass QTL 51	3		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	51786282	91669536	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
6893336	Cm75	Cardiac mass QTL 75	0.1	0.87	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	61345276	99703528	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47369470	92369470	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
12880055	Am11	Aortic mass QTL 11		0.004	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	84007272	95933025	Rat
2292438	Bp311	Blood pressure QTL 311			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	107211142	Rat
2312662	Slep8	Serum leptin concentration QTL 8		0.05	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	10	57134272	102134272	Rat
2301398	Kidm38	Kidney mass QTL 38		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	84007272	95933025	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	85565469	103884409	Rat
1358188	Ept9	Estrogen-induced pituitary tumorigenesis QTL 9	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73453136	96120911	Rat
631537	Oia4	Oil induced arthritis QTL 4			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	75631887	87055282	Rat
1642980	Bp300	Blood pressure QTL 300			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68383129	107211142	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
2312668	Scl65	Serum cholesterol level QTL 65		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	57134272	102134272	Rat

Markers in Region

RH142782

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	86,818,658 - 86,818,803 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	89,797,219 - 89,797,363	NCBI	Rnor6.0
Rnor_5.0	10	89,590,790 - 89,590,934	UniSTS	Rnor5.0
RGSC_v3.4	10	90,921,797 - 90,921,941	UniSTS	RGSC3.4
Celera	10	85,538,725 - 85,538,869	UniSTS
RH 3.4 Map	10	884.5	UniSTS
Cytogenetic Map	10	q32.1	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	82	79	78	47	23	47	6	204	95	62	45	58	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108837	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008768090	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269547	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028220 ⟹ ENSRNOP00000028220

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	86,818,478 - 86,837,660 (-)	Ensembl
Rnor_6.0 Ensembl	10	89,797,038 - 89,816,491 (-)	Ensembl

RefSeq Acc Id:

NM_001108837 ⟹ NP_001102307

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	87,318,668 - 87,337,777 (-)	NCBI
mRatBN7.2	10	86,818,450 - 86,837,563 (-)	NCBI
Rnor_6.0	10	89,797,011 - 89,816,491 (-)	NCBI
Rnor_5.0	10	89,590,582 - 89,609,632 (-)	NCBI
RGSC_v3.4	10	90,921,589 - 90,942,298 (-)	RGD
Celera	10	85,538,517 - 85,557,370 (-)	RGD

Sequence:

show sequence

ATGGATCCGGTGGTCAACAGCTGCGTGAGGAACCCCCAGCCCCCAGCTCCCGTCTGGGGCTGCC
TTCGAAACCCCCACTCGGAAGGCAGCAGCGCCTCAGGGCTGCCCCATTACCCACCAACCCCGTT
TTCCTTCCACCAAAAGTCCGATTTCCCAGCGACAGCAGCATACCCCGACTTCTCTACTTCCTGC
CTGGCAGCCACCCCACACAGCCTGCCCCGCGCTGAGCGAATCTTCAATGAGCAGCATCCTGCCT
TCCCACAGACCCCTGACTGGCATTTCCCCATCTCTGAAGCGGGGCAAAGGCTCAACCTAGGCCC
AGCTGGGAGCGCCAGAGAGATGGGGGCTGGCAGCCCCGGCCTGGTGGACGGCACAGGAGGATTG
GGTGAGGACTGCATGGTGCTTGGGACCATCGCCCATGAGACGGAGAAGAAATTATCCAGAAGGA
AAAAGGAGAGGTCAGACAACCCAGAGAATGGAGGAGGAAAGCCAGAAGGCAGCAGCAAGGCCCG
GAAGGAAAGGACAGCTTTCACCAAGGAGCAGCTACGGGAGCTAGAGGCTGAGTTCGCCCACCAT
AACTACCTGACCAGGCTCCGTAGATACGAGATTGCAGTCAACCTGGACCTTTCAGAGCGGCAGG
TCAAAGTGTGGTTCCAGAACCGGAGAATGAAGTGGAAGCGTGTGAAGGGGGGTCAGCCCGTGTC
CCCACAGGAGCAGGACCCAGAGGATGGAGACTCTGCAGCTTCTCCGAGTTCAGAGTGAGATGCT
CCAAAGACCAAAACCAAGAAAGACTGAACGAACGCCCTTTCCAACTCCCACCACCCACTCCCAC
CCTCACATCTTCTGGACCCACCCAGGCAGCCTGCGCACACTCGTACGTAGATGTGAAGTTGCCC
AGTGTGGGAGCCTTGAATTTCCCAGAAGGTTTAGCCCAGCATCGCCCCAGTCTCAGCAGCCCCT
TCCCCAGGGCTTCAATTTTCCACACTCTCTTGAACTCCACAGGACCCAGCGGACTGGGAAACTC
TAGAAACAGAACCTGGGACACTCTTTTCTGGGTCTCTTGGCTGCTACCCACACCTACCATCCCC
CTCTTACATCAAGTCTCCTCTGGGTCTGGCCCCATATGGCCTGTGCAGAATCCATTCCTTGGTA
CCAGCTGGTGACTTGTAAAAGCAAAACCCTCTCCAGATGTTCACACCATTGCATTGAGTGGAAG
GCTAGAAAGTGGCTCCTGTCTCTAAGGACGGAGAGACTAGCACAAGAGCTGATGGATGATGACC
TAGACACATGGACCTCAGGCTACAGCATCCTGTGTGCTCTAAGGACTCTGACTGCAAATGAAGA
CAGGAAAACAGTCCATCTTCCTCCATGGGATGCATCTGGACCTGTCCTGCATGTTCCCCAAAGC
TATTTTGTGGGAAGAACTCCCAGGTTCACACACATGGGCAGCTCAAATCTCAGACCCAACTTCT
AAGAATGCCGCTGTGAGGACTGGTGGGCAGACAGCCTCGGGCAGCAGTATCCTTGGAGGAGACC
CCGTATGCCTCAGTATTAGATGGTGGCTCTCGCAGGTCCTGCTGTTGTTGCAGAAGGAGGTCAG
CAAGTGTTTGGATTTCTTGCATGTAGATTTGATTGCCAGTGTTTAAAAATAACCCCGGTTCCCC
ACCCCACCCCATCAAGACAGAAGCTGTGGAAAATGATTGTCAAATGAGATGGCAAGTTAAAGCA
TGTATCAGTTTCCCCCTAAAGCATACTTCATATGGTTTTTTTTTCTAAGATTATGTCAAAAAAT
TGTGCAAGGTCAATTCACTTTGTAAGAAAACTCTCGGAGAAATAAATCAACCAAAAAAAAAAAA
AAAAAAAGCAGTTTC

hide sequence

RefSeq Acc Id:

XM_063269547 ⟹ XP_063125617

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	87,318,676 - 87,338,169 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001102307	(Get FASTA)	NCBI Sequence Viewer
	XP_063125617	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM06158	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028220
	ENSRNOP00000028220.3

RefSeq Acc Id:

NP_001102307 ⟸ NM_001108837

- UniProtKB:

D4A532 (UniProtKB/TrEMBL), A6HJF3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDPVVNSCVRNPQPPAPVWGCLRNPHSEGSSASGLPHYPPTPFSFHQKSDFPATAAYPDFSTSC
LAATPHSLPRAERIFNEQHPAFPQTPDWHFPISEAGQRLNLGPAGSAREMGAGSPGLVDGTGGL
GEDCMVLGTIAHETEKKLSRRKKERSDNPENGGGKPEGSSKARKERTAFTKEQLRELEAEFAHH
NYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPVSPQEQDPEDGDSAASPSSE

hide sequence

Ensembl Acc Id:

ENSRNOP00000028220 ⟸ ENSRNOT00000028220

RefSeq Acc Id:	XP_063125617 ⟸ XM_063269547
- Peptide Label:	isoform X1

Protein Domains

Homeobox

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A532-F1-model_v2	AlphaFold	D4A532	1-253	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308911	AgrOrtholog
BioCyc Gene	G2FUF-23136	BioCyc
Ensembl Genes	ENSRNOG00000020803	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000028220	ENTREZGENE
	ENSRNOT00000028220.7	UniProtKB/TrEMBL
Gene3D-CATH	Homeodomain-like	UniProtKB/TrEMBL
InterPro	Homeobox_CS	UniProtKB/TrEMBL
	Homeobox_metazoa	UniProtKB/TrEMBL
	Homeodomain	UniProtKB/TrEMBL
	Homeodomain-like	UniProtKB/TrEMBL
	MOX-1/MOX-2	UniProtKB/TrEMBL
KEGG Report	rno:363684	UniProtKB/TrEMBL
NCBI Gene	363684	ENTREZGENE
PANTHER	HOMEOBOX PROTEIN MOX-1	UniProtKB/TrEMBL
	PTHR24328	UniProtKB/TrEMBL
Pfam	Homeobox	UniProtKB/TrEMBL
PhenoGen	Meox1	PhenoGen
PRINTS	HOMEOBOX	UniProtKB/TrEMBL
PROSITE	HOMEOBOX_1	UniProtKB/TrEMBL
	HOMEOBOX_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000020803	RatGTEx
SMART	HOX	UniProtKB/TrEMBL
Superfamily-SCOP	Homeodomain_like	UniProtKB/TrEMBL
UniProt	A6HJF3	ENTREZGENE, UniProtKB/TrEMBL
	D4A532	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Meox1	mesenchyme homeobox 1	Meox1_predicted	mesenchyme homeobox 1 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Meox1_predicted	mesenchyme homeobox 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM