Dnlz (DNL-type zinc finger) - Rat Genome Database

Name: Dnlz
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Dnlz (DNL-type zinc finger) Rattus norvegicus

Analyze

Symbol:

Dnlz

Name:

DNL-type zinc finger

RGD ID:

1308635

Description:

Predicted to enable protein folding chaperone and protein-folding chaperone binding activity. Predicted to be involved in several processes, including chaperone-mediated protein complex assembly; protein import into mitochondrial matrix; and protein stabilization. Predicted to be located in nucleoplasm. Predicted to be active in cytosol; mitochondrion; and nucleus. Orthologous to human DNLZ (DNL-type zinc finger); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC296587; MGC189536; RGD1308635; similar to CG12379-PA

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DNLZ (DNL-type zinc finger)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Dnlz (DNL-type zinc finger)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dnlz (DNL-type zinc finger)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DNLZ (DNL-type zinc finger)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DNLZ (DNL-type zinc finger)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dnlz (DNL-type zinc finger)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DNLZ (DNL-type zinc finger)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DNLZ (DNL-type zinc finger)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dnlz (DNL-type zinc finger)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Dnlz (DNL-type zinc finger)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	DNLZ (DNL-type zinc finger)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dnlz (DNL-type zinc finger)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG12379	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F53A3.7	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ZIM17	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	dnlz	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	29,568,041 - 29,569,937 (-)	NCBI		GRCr8
mRatBN7.2	3	9,169,948 - 9,171,727 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	9,169,793 - 9,180,551 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	12,223,325 - 12,225,104 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	20,806,555 - 20,808,334 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	19,061,892 - 19,063,671 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	3,796,480 - 3,798,467 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	3,796,480 - 3,798,239 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	9,157,626 - 9,159,542 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	4,522,915 - 4,524,662 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	4,522,914 - 4,524,733 (-)	NCBI
Celera	3	3,989,863 - 3,991,610 (-)	NCBI		Celera
Cytogenetic Map	3	p13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Adams-Oliver Syndrome 5 (ISO)

autosomal dominant intellectual developmental disorder 8 (ISO)

autosomal dominant nocturnal frontal lobe epilepsy 5 (ISO)

developmental and epileptic encephalopathy 14 (ISO)

Ehlers-Danlos syndrome classic type 1 (ISO)

Joubert syndrome 1 (ISO)

Kleefstra syndrome 1 (ISO)

Leigh disease (ISO)

primary coenzyme Q10 deficiency 7 (ISO)

Rafiq syndrome (ISO)

tuberous sclerosis 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

cadmium dichloride (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dibutyl phthalate (ISO)

endosulfan (EXP)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

glafenine (EXP)

indole-3-methanol (EXP)

inulin (ISO)

nefazodone (EXP)

nimesulide (EXP)

paracetamol (EXP)

paraquat (EXP)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

quercetin (ISO)

sunitinib (ISO)

temozolomide (ISO)

tetrachloromethane (EXP)

titanium dioxide (ISO)

trichostatin A (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chaperone-mediated protein complex assembly (ISO)

protein folding (IBA)

protein import into mitochondrial matrix (IBA)

protein stabilization (IBA)

Cellular Component

cytosol (ISO)

mitochondrion (IBA,ISO)

nucleoplasm (ISO)

nucleus (ISO)

Molecular Function

protein folding chaperone (ISO)

protein-folding chaperone binding (IBA)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8889548	PMID:12477932	PMID:18614015

Genomics

Comparative Map Data

Dnlz
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	29,568,041 - 29,569,937 (-)	NCBI		GRCr8
mRatBN7.2	3	9,169,948 - 9,171,727 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	9,169,793 - 9,180,551 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	12,223,325 - 12,225,104 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	20,806,555 - 20,808,334 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	19,061,892 - 19,063,671 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	3,796,480 - 3,798,467 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	3,796,480 - 3,798,239 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	9,157,626 - 9,159,542 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	4,522,915 - 4,524,662 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	4,522,914 - 4,524,733 (-)	NCBI
Celera	3	3,989,863 - 3,991,610 (-)	NCBI		Celera
Cytogenetic Map	3	p13	NCBI

DNLZ
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	136,359,483 - 136,363,744 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	136,359,480 - 136,363,744 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	139,253,935 - 139,258,196 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	138,376,173 - 138,378,062 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	9	109,771,288 - 109,773,177 (-)	NCBI		Celera
Cytogenetic Map	9	q34.3	NCBI
HuRef	9	108,715,708 - 108,717,619 (-)	NCBI		HuRef
CHM1_1	9	139,404,548 - 139,406,459 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	148,588,818 - 148,593,075 (-)	NCBI		T2T-CHM13v2.0

Dnlz
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	26,238,130 - 26,242,122 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	26,238,133 - 26,242,122 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	26,348,118 - 26,352,110 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	26,348,121 - 26,352,110 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	26,203,638 - 26,207,630 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	26,203,643 - 26,207,630 (-)	NCBI		MGSCv36	mm8
Celera	2	26,065,813 - 26,069,805 (-)	NCBI		Celera
Cytogenetic Map	2	A3	NCBI
cM Map	2	18.87	NCBI

Dnlz
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955513	4,359,421 - 4,361,081 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955513	4,359,421 - 4,361,081 (+)	NCBI	ChiLan1.0	ChiLan1.0

DNLZ
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	3,022,675 - 3,024,687 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	3,025,204 - 3,029,437 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	107,432,709 - 107,436,360 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	136,411,832 - 136,416,279 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

DNLZ
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	49,120,802 - 49,122,789 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	49,120,818 - 49,122,804 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	48,371,497 - 48,373,350 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	49,997,572 - 49,999,427 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	49,997,567 - 50,001,581 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	48,778,121 - 48,779,896 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	49,072,294 - 49,074,228 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	49,119,821 - 49,121,756 (+)	NCBI		UU_Cfam_GSD_1.0

Dnlz
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	201,935,149 - 201,936,953 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936669	1,438,227 - 1,439,814 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936669	1,438,129 - 1,439,909 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DNLZ
(Sus scrofa - pig)

No map positions available.

DNLZ
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	1,841,598 - 1,846,006 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	1,841,738 - 1,843,462 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666058	3,370,130 - 3,374,604 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dnlz
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624760	1,531,439 - 1,533,170 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624760	1,531,439 - 1,533,176 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Dnlz
3 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	106
Count of miRNA genes:	87
Interacting mature miRNAs:	89
Transcripts:	ENSRNOT00000025386
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358357	Srcrtb1	Stress Responsive Cort Basal QTL 1	6.36	0.002	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	8658162	27494778	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	1	36847613	Rat
2292615	Ept17	Estrogen-induced pituitary tumorigenesis QTL 17	6.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	6537645	10778823	Rat
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	8227194	47233430	Rat
1298526	Arunc3	Aerobic running capacity QTL 3	2.2		exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	8227194	33703538	Rat
631545	Bp85	Blood pressure QTL 85	3.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	33278763	Rat
631679	Cm10	Cardiac mass QTL 10	7.34	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	1	31158234	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
631568	Bp92	Blood pressure QTL 92	2.2	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	39874793	Rat
70203	Gcr2	Gastric cancer resistance QTL 2	2.6		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	3	8658162	27494778	Rat
70202	Alc19	Alcohol consumption QTL 19	2.5		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	3	1	27494778	Rat
2312664	Scl62	Serum cholesterol level QTL 62		0.05	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	1	38710544	Rat
61468	Bp15	Blood pressure QTL 15	4.4		blood pressure trait (VT:0000183)	pulse pressure (CMO:0000292)	3	1	33278763	Rat
1358185	Ept6	Estrogen-induced pituitary tumorigenesis QTL 6	6.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	6537645	10778823	Rat
631831	Alc8	Alcohol consumption QTL 8	2.7		consumption behavior trait (VT:0002069)	calculated ethanol drink intake rate (CMO:0001615)	3	1	33230976	Rat

Markers in Region

RH125204

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	9,170,008 - 9,170,170 (+)	MAPPER	mRatBN7.2
mRatBN7.2	3	9,170,008 - 9,171,636 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	3,796,541 - 3,798,168	NCBI	Rnor6.0
Rnor_6.0	3	3,796,541 - 3,796,702	NCBI	Rnor6.0
Rnor_5.0	3	9,157,688 - 9,159,315	UniSTS	Rnor5.0
Rnor_5.0	3	9,157,688 - 9,157,849	UniSTS	Rnor5.0
RGSC_v3.4	3	4,522,976 - 4,523,137	UniSTS	RGSC3.4
RGSC_v3.4	3	4,522,976 - 4,524,603	UniSTS	RGSC3.4
Celera	3	3,989,924 - 3,991,551	UniSTS
Celera	3	3,989,924 - 3,990,085	UniSTS
Cytogenetic Map	3	p13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001130990	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NR_024073	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283470	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC129824	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC167097	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BQ205125	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232660	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025386 ⟹ ENSRNOP00000025386

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	9,169,793 - 9,180,551 (-)	Ensembl
Rnor_6.0 Ensembl	3	3,796,480 - 3,798,177 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076156 ⟹ ENSRNOP00000068367

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	3	3,796,480 - 3,798,227 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076487 ⟹ ENSRNOP00000068138

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	3	3,796,480 - 3,798,239 (-)	Ensembl

RefSeq Acc Id:

NM_001130990 ⟹ NP_001124462

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	29,568,041 - 29,569,820 (-)	NCBI
mRatBN7.2	3	9,169,948 - 9,171,727 (-)	NCBI
Rnor_6.0	3	3,796,480 - 3,798,227 (-)	NCBI
Rnor_5.0	3	9,157,626 - 9,159,542 (-)	NCBI
RGSC_v3.4	3	4,522,915 - 4,524,662 (-)	RGD
Celera	3	3,989,863 - 3,991,610 (-)	RGD

Sequence:

show sequence

CGGATACAGCTTCAGTTGTACGGGGCGGTGCAAAAAGAGGTGGCCAAGAATCGTCGTGGTGACG
GTGCCCTGGAACGGCATGTTGCGGACAGCGCTGAGCCGCATGCCGACACTACTTCGTAGTGTGA
GGACCCGGGATTCCGGACCGCGGCAGCTTTGGGATTTGGGGGCTCGCCTAAAAACCGCGAAGAG
ACTTCGGGGCTGGGCCTGGGGCTGGCGGAGCTCGAGCTCCGCGCCGGGATCAGAGCATGCGGCG
GCGCTAGGGCGCGTGAAAGCGGACCACTACCAGCTCGTCTACACCTGCAAGGTCTGTGGGACTC
GGTCATCCAAGCACATCTCAAAGTTGGCCTATCACCAGGGTGTGGTCATCGTGACTTGCCCTGG
TTGCCAGAACCACCACATCATCGCAGACAACCTAAGCTGGTTCTCTGACCTGAAGGGGAAGAGG
AACATTGAAGAGATCCTAGCAGCCAGAGGAGAGGAGGTACGCCGGGTGTGCGGTGACGGTGCCT
TGGAACTGATTCTGGAGGTGGCTGAACCACCTGCCACCCCAGAAGGGGGTGAAGATCCCACTCA
CCCCGGCAAGATGGACCAGAGCTGACCCCGTACACTCTTGCAACTGTGGACTCCTCCAACTTCA
GACTCCAGTCTTCCCAAAAGTCTCCCCCTTCACTTGGAGCCTCTCCAGCCTGCTGTTCTCTGTC
AGTAAACAACTGTCAATCCAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NR_024073

RefSeq Status:

VALIDATED

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	29,568,041 - 29,569,820 (-)	NCBI
mRatBN7.2	3	9,169,948 - 9,171,727 (-)	NCBI
Rnor_6.0	3	3,796,480 - 3,798,227 (-)	NCBI
Rnor_5.0	3	9,157,626 - 9,159,542 (-)	NCBI
RGSC_v3.4	3	4,522,915 - 4,524,662 (-)	RGD
Celera	3	3,989,863 - 3,991,610 (-)	RGD

Sequence:

show sequence

CGGATACAGCTTCAGTTGTACGGGGCGGTGCAAAAAGAGGTGGCCAAGAATCGTCGTGGTGACG
GTGCCCTGGAACGGCATGTTGCGGACAGCGCTGAGCCGCATGCCGACACTACTTCGTAGTGTGA
GGACCCGGGATTCCGGACCGCGGCAGCTTTGGGATTTGGGGGCTCGCCTAAAAACCGCGAAGAG
ACTTCGGGGCTGGGCCTGGGGCTGGCGGAGCTCGAGCTCCGCGCCGGGATCAGAGCATGCGGCG
GCGCTAGGGCGCGTGAAAGCGGACCACTACCAGCTCGTCTACACCTGCAAGGTGGGCGCGGTCG
GCAGCACCCAGCGCTGGCTGGTTTCCTGAAGGTCTGTGGGACTCGGTCATCCAAGCACATCTCA
AAGTTGGCCTATCACCAGGGTGTGGTCATCGTGACTTGCCCTGGTTGCCAGAACCACCACATCA
TCGCAGACAACCTAAGCTGGTTCTCTGACCTGAAGGGGAAGAGGAACATTGAAGAGATCCTAGC
AGCCAGAGGAGAGGAGGTACGCCGGGTGTGCGGTGACGGTGCCTTGGAACTGATTCTGGAGGTG
GCTGAACCACCTGCCACCCCAGAAGGGGGTGAAGATCCCACTCACCCCGGCAAGATGGACCAGA
GCTGACCCCGTACACTCTTGCAACTGTGGACTCCTCCAACTTCAGACTCCAGTCTTCCCAAAAG
TCTCCCCCTTCACTTGGAGCCTCTCCAGCCTGCTGTTCTCTGTCAGTAAACAACTGTCAATCCA
AAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063283470 ⟹ XP_063139540

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	29,569,128 - 29,569,937 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001124462	(Get FASTA)	NCBI Sequence Viewer
	XP_063139540	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL93510	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025386.5

RefSeq Acc Id:	NP_001124462 ⟸ NM_001130990
- UniProtKB:	A6JTD6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLRTALSRMPTLLRSVRTRDSGPRQLWDLGARLKTAKRLRGWAWGWRSSSSAPGSEHAAALGRV KADHYQLVYTCKVCGTRSSKHISKLAYHQGVVIVTCPGCQNHHIIADNLSWFSDLKGKRNIEEI LAARGEEVRRVCGDGALELILEVAEPPATPEGGEDPTHPGKMDQS hide sequence

Ensembl Acc Id:

ENSRNOP00000025386 ⟸ ENSRNOT00000025386

Ensembl Acc Id:

ENSRNOP00000068367 ⟸ ENSRNOT00000076156

Ensembl Acc Id:

ENSRNOP00000068138 ⟸ ENSRNOT00000076487

RefSeq Acc Id:	XP_063139540 ⟸ XM_063283470
- Peptide Label:	isoform X1

Protein Domains

DNL-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZWJ1-F1-model_v2	AlphaFold	D3ZWJ1	1-173	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691901

Promoter ID:

EPDNEW_R2426

Type:

multiple initiation site

Name:

Dnlz_1

Description:

DNL-type zinc finger

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	3,798,169 - 3,798,229	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308635	AgrOrtholog
BioCyc Gene	G2FUF-50387	BioCyc
Ensembl Genes	ENSRNOG00000018791	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000025386.7	UniProtKB/TrEMBL
InterPro	Mt_import_TIM15	UniProtKB/TrEMBL
	Znf_Zim17	UniProtKB/TrEMBL
KEGG Report	rno:296587	UniProtKB/TrEMBL
NCBI Gene	296587	ENTREZGENE
PANTHER	DNL-TYPE ZINC FINGER PROTEIN	UniProtKB/TrEMBL
	Znf_Zim17	UniProtKB/TrEMBL
Pfam	zf-DNL	UniProtKB/TrEMBL
PhenoGen	Dnlz	PhenoGen
PROSITE	ZF_DNL	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000018791	RatGTEx
UniProt	A6JTD6	ENTREZGENE, UniProtKB/TrEMBL
	D3ZWJ1_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-22	Dnlz	DNL-type zinc finger	RGD1308635	similar to CG12379-PA	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1308635	similar to CG12379-PA	RGD1308635_predicted	similar to CG12379-PA (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-20	RGD1308635_predicted	similar to CG12379-PA (predicted)	LOC296587_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC296587_predicted	similar to CG12379-PA (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar