Advanced Search (OLGA)

Gene: Dcaf13 (DDB1 and CUL4 associated factor 13) Rattus norvegicus

Analyze

Symbol:

Dcaf13

Name:

DDB1 and CUL4 associated factor 13

RGD ID:

1308458

Description:

Predicted to enable nuclear estrogen receptor binding activity and ubiquitin-like ligase-substrate adaptor activity. Predicted to be involved in several processes, including decidualization; oocyte growth; and spindle assembly involved in female meiosis. Predicted to be located in several cellular components, including centrosome; cytosol; and nucleoplasm. Predicted to be part of Cul4-RING E3 ubiquitin ligase complex and small-subunit processome. Predicted to be active in nucleolus. Orthologous to human DCAF13 (DDB1 and CUL4 associated factor 13); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

DDB1- and CUL4-associated factor 13; gene model 83, (NCBI); Gm83; LOC362902; WD repeats and SOF domain containing 1; WD repeats and SOF1 domain containing; Wdsof1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DCAF13 (DDB1 and CUL4 associated factor 13)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Dcaf13 (DDB1 and CUL4 associated factor 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dcaf13 (DDB1 and CUL4 associated factor 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DCAF13 (DDB1 and CUL4 associated factor 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DCAF13 (DDB1 and CUL4 associated factor 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dcaf13 (DDB1 and CUL4 associated factor 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DCAF13 (DDB1 and CUL4 associated factor 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DCAF13 (DDB1 and CUL4 associated factor 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dcaf13 (DDB1 and CUL4 associated factor 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	DCAF13 (DDB1 and CUL4 associated factor 13)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Dcaf13 (DDB1 and CUL4 associated factor 13)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dcaf13 (ddb1 and cul4 associated factor 13)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG7275	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SOF1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ZK430.7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	dcaf13	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	72,045,828 - 72,081,039 (+)	NCBI		GRCr8
mRatBN7.2	7	70,160,983 - 70,196,142 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	70,160,941 - 70,196,142 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	72,034,138 - 72,069,389 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	74,236,651 - 74,271,908 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	74,104,737 - 74,139,984 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	78,005,232 - 78,040,220 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	78,005,232 - 78,040,214 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	78,209,274 - 78,244,263 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	74,668,602 - 74,703,968 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	74,689,351 - 74,724,698 (+)	NCBI
Celera	7	67,217,401 - 67,252,558 (+)	NCBI		Celera
Cytogenetic Map	7	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Cohen syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

amitrole (EXP)

Aroclor 1254 (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bortezomib (ISO)

CGP 52608 (ISO)

chlormequat chloride (EXP)

copper atom (ISO)

copper(0) (ISO)

cyclosporin A (ISO)

dicrotophos (ISO)

disulfiram (ISO)

finasteride (EXP)

fipronil (EXP)

flutamide (EXP)

hydrogen peroxide (ISO)

ketamine (EXP)

kojic acid (ISO)

lead(0) (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

nefazodone (EXP)

nickel atom (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

propiconazole (EXP)

silicon dioxide (ISO)

sulfadimethoxine (EXP)

tetrachloromethane (ISO)

thimerosal (ISO)

thioacetamide (EXP)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

decidualization (ISO)

epigenetic programming in the zygotic pronuclei (ISO)

maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (IBA)

oocyte growth (ISO)

proteasome-mediated ubiquitin-dependent protein catabolic process (ISO)

rRNA processing (ISO)

spindle assembly involved in female meiosis (ISO)

Cellular Component

cell junction (IEA,ISO)

centrosome (IEA,ISO)

Cul4-RING E3 ubiquitin ligase complex (ISO)

cytosol (IEA,ISO)

nucleolus (IBA,ISO)

nucleoplasm (IEA,ISO)

small-subunit processome (IBA)

Molecular Function

nuclear estrogen receptor binding (ISO)

protein binding (ISO)

ubiquitin-like ligase-substrate adaptor activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:16949367	PMID:22658674	PMID:22681889	PMID:28068668

Genomics

Comparative Map Data

Dcaf13
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	72,045,828 - 72,081,039 (+)	NCBI		GRCr8
mRatBN7.2	7	70,160,983 - 70,196,142 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	70,160,941 - 70,196,142 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	72,034,138 - 72,069,389 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	74,236,651 - 74,271,908 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	74,104,737 - 74,139,984 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	78,005,232 - 78,040,220 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	78,005,232 - 78,040,214 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	78,209,274 - 78,244,263 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	74,668,602 - 74,703,968 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	74,689,351 - 74,724,698 (+)	NCBI
Celera	7	67,217,401 - 67,252,558 (+)	NCBI		Celera
Cytogenetic Map	7	q31	NCBI

DCAF13
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	103,415,386 - 103,443,453 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	103,414,714 - 103,443,453 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	104,427,614 - 104,455,681 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	104,496,118 - 104,524,376 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	8	100,613,481 - 100,642,207 (+)	NCBI		Celera
Cytogenetic Map	8	q22.3	NCBI
HuRef	8	99,627,291 - 99,656,018 (+)	NCBI		HuRef
CHM1_1	8	104,467,741 - 104,496,445 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	104,543,035 - 104,571,087 (+)	NCBI		T2T-CHM13v2.0

Dcaf13
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	38,976,300 - 39,010,251 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	38,976,260 - 39,010,251 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	39,112,874 - 39,146,856 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	39,112,865 - 39,146,856 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	38,944,420 - 38,978,402 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	38,943,006 - 38,976,930 (+)	NCBI		MGSCv36	mm8
Celera	15	39,600,285 - 39,634,269 (+)	NCBI		Celera
Cytogenetic Map	15	B3.1	NCBI
cM Map	15	15.42	NCBI

Dcaf13
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955417	27,544,242 - 27,569,715 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955417	27,545,128 - 27,567,829 (+)	NCBI	ChiLan1.0	ChiLan1.0

DCAF13
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	120,780,993 - 120,809,175 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	96,317,081 - 96,345,064 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	100,070,628 - 100,098,885 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	102,226,116 - 102,254,900 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	102,226,116 - 102,254,900 (+)	Ensembl	panpan1.1		panPan2

DCAF13
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	4,835,147 - 4,860,706 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	4,834,958 - 4,860,247 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	4,838,774 - 4,863,783 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	4,999,335 - 5,024,396 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	4,999,453 - 5,025,111 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	4,839,637 - 4,864,677 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	4,957,559 - 4,982,592 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	4,970,339 - 4,995,381 (+)	NCBI		UU_Cfam_GSD_1.0

Dcaf13
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	32,895,023 - 32,931,004 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936470	40,320,073 - 40,356,993 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936470	40,321,103 - 40,357,001 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DCAF13
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	33,672,871 - 33,704,573 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	33,672,867 - 33,704,888 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	36,445,544 - 36,477,231 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DCAF13
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	98,271,304 - 98,297,950 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666039	42,303,922 - 42,330,346 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dcaf13
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624763	19,955,408 - 19,980,620 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624763	19,955,368 - 19,980,480 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Dcaf13
93 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	35
Count of miRNA genes:	32
Interacting mature miRNAs:	34
Transcripts:	ENSRNOT00000005803
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
2293667	Bss42	Bone structure and strength QTL 42	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	7	47651439	92651439	Rat
10053722	Scort27	Serum corticosterone level QTL 27	2.41	0.0083	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	43228750	88228750	Rat
2317035	Aia16	Adjuvant induced arthritis QTL 16	2.71		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	59238038	104238038	Rat
1300127	Srn1	Serum renin concentration QTL 1	3.87		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	7	29409683	84928080	Rat
2293678	Bss24	Bone structure and strength QTL 24	6.71	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	7	47651439	92651439	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	43747012	108555253	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	69736356	112729554	Rat
631513	Scl7	Serum cholesterol level QTL 7	4.1		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	37960569	82960569	Rat
2293685	Bmd21	Bone mineral density QTL 21	4.2	0.0003	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	7	47651439	92651439	Rat
10755453	Coatc12	Coat color QTL 12		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	31112832	76112832	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
634326	Hc3	Hypercalciuria QTL 3	2.1		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	7	42787314	87787314	Rat
2293696	Bmd32	Bone mineral density QTL 32	5.1	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	7	47651439	92651439	Rat
7411605	Foco14	Food consumption QTL 14	24.1	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	34293282	79293282	Rat
1300151	Bp181	Blood pressure QTL 181	3.36		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	7	53612714	103945643	Rat
1559283	Emca4	Estrogen-induced mammary cancer QTL 4	3.7		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	7	62004452	101773158	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
738030	Anxrr8	Anxiety related response QTL 8	4.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	46590070	91590070	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	43747099	102228765	Rat
631534	Lnnr1	Liver neoplastic nodule remodeling QTL 1	3.85	0.001	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	7	34293282	79293282	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
2293707	Bss32	Bone structure and strength QTL 32	7.64	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	47651439	92651439	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
2293644	Bmd29	Bone mineral density QTL 29	5.4	0.0001	femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	7	47651439	92651439	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	68938720	113886318	Rat
2300178	Bmd54	Bone mineral density QTL 54	5.3	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	7	47651439	92651439	Rat
1298528	Bp169	Blood pressure QTL 169		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	61074194	106074194	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	44867533	89867533	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	19654317	84928080	Rat
1576303	Ept7	Estrogen-induced pituitary tumorigenesis QTL 7	3.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	7	62004452	101773158	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	68938720	113886318	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	29409683	74409683	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	68938720	113886318	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	69736226	117455174	Rat

Markers in Region

BI290204

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	70,166,665 - 70,167,239 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	78,011,090 - 78,011,663	NCBI	Rnor6.0
Rnor_5.0	7	78,237,832 - 78,238,405	UniSTS	Rnor5.0
RGSC_v3.4	7	74,674,274 - 74,674,847	UniSTS	RGSC3.4
Celera	7	67,223,084 - 67,223,657	UniSTS
RH 3.4 Map	7	625.5	UniSTS
Cytogenetic Map	7	q22	UniSTS

AI413044

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	70,196,224 - 70,196,390 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	78,040,300 - 78,040,465	NCBI	Rnor6.0
Rnor_5.0	7	78,209,030 - 78,209,195	UniSTS	Rnor5.0
RGSC_v3.4	7	74,704,051 - 74,704,216	UniSTS	RGSC3.4
Celera	7	67,252,641 - 67,252,806	UniSTS
RH 3.4 Map	7	630.7	UniSTS
Cytogenetic Map	7	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001173558	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006241605	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063263835	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063263836	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC158730	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EV763930	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218394	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225398	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228874	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229670	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005803 ⟹ ENSRNOP00000005803

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	70,160,941 - 70,196,142 (+)	Ensembl
Rnor_6.0 Ensembl	7	78,005,232 - 78,040,214 (+)	Ensembl

RefSeq Acc Id:

NM_001173558 ⟹ NP_001167029

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	72,045,882 - 72,081,039 (+)	NCBI
mRatBN7.2	7	70,160,983 - 70,196,142 (+)	NCBI
Rnor_6.0	7	78,005,232 - 78,040,217 (+)	NCBI
Rnor_5.0	7	78,209,274 - 78,244,263 (-)	NCBI
Celera	7	67,217,401 - 67,252,558 (+)	NCBI

Sequence:

show sequence

CGTGGAGGCCGGGTTAAGTCGAGCTCGGCTTAAAGGCTCGAGGAGTCCTAGACCCAGAGCCGCC
AAAATGAAGGTGAAAATGCTGAGCCGGAACCCTGACAACTATGTCCGCGAAACCAAGCTGGACA
TACAAAGAGTTCCAAGAAACTACGATCCTACTTTACATCCTTTTGAAGTCCCAAGAGAATATGT
AAGAGCTTTAAATGCTACCAAGTTGGAACGGGTGTTCGCAAAACCATTCCTTGCTTCCCTGGAT
GGTCACCGTGATGGAGTCAATTGCCTGGCCAAGCATCCAAAGAGCCTGGCTACTGTTCTTTCTG
GGGCGTGTGATGGAGAGGTTAAAATTTGGAACCTGACTAAACGAAAATGTATCCGAACGATACA
AGCACATGAAGGTTTTGTCCGAGGAATATGCACTCGCTTTTGTGGAACTTCTTTTTTTACTGTC
GGAGATGACAAAACTGTGAAGCAGTGGAAAATGGATGGACCAGGCTGCGGAGAGGAGGAGGAAC
CGTTGTACACGGTGTTAGGAAAGACAGTATATACTGGCATTGATCATCACTGGAAAGACCCGGC
CTTTGCCACGTGTGGACAGCAAGTAGACATTTGGGATGAACAAAGAACCAGCCCTGTGTGCTCA
ATGAACTGGGGATTTGACAGTATAAGTAGTGTTAAATTTAACCCTATTGAGACATATCTCTTGG
GAAGTTGTGCTTCTGATAGGAATATAGTACTGTATGATATGCGGCAAGCTACTCCTTTGAAAAA
GGTTATCCTAGATATGAGAACAAATACAATCTGTTGGAACCCTATGGAAGCTTTCAATTTTACT
GCAGCCAATGAAGACTATAACTTGTATACTTTTGATATGCGTGCACTGGACACTCCTGTTATGG
TCCACCTGGATCATGTATCTGCAGTGCTTGATGTAGACTACTCTCCGACTGGGAAGGAATTTGT
GTCTGCTAGTTTTGATAAGTCTATTAGAATCTTCCCTGTGGACAAAAGCCGAAGCAGGGAAGTG
TATCATACGAGGCGCATGCAGCATGTTATTTGTGTGAAATGGACTTCTGACAGCAAGTACATTC
TGTGTGGGTCTGATGAGATGAACATCCGGCTGTGGAAAGCCAATGCCTCTGAAAAATTGGGTGT
GCTTACATCACGAGAAAGAGCAGCAAATGATTATAACCAGAAGTTAAAGGAAAAATTTCAGTAC
CATCCACATGTGAAACGGATTGCTCGCCACCGACATCTGCCAAAATCTATCTACAGCCAGATTC
AGGAGCAGCGTGTTATGAAGGAGGCTCGTCGCCGCAAGGAAATGAATCGTCGTAAACATAGCAA
GCCTGGATCTGTGCCAGTTGTGTCAGAGAGGAAGAAACACGTAGTGGCGGTTGTGAAATAATGT
TTTGTCTTCCTACCAAGCTTGATATATAATTATTTGCTACTTTTGATTTGGGAACTCTGTAAAT
AAAAGTCCTGGCCCTGGTTAATAGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063263835 ⟹ XP_063119905

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	72,045,828 - 72,081,039 (+)	NCBI

RefSeq Acc Id:

XM_063263836 ⟹ XP_063119906

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	72,056,553 - 72,081,039 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001167029	(Get FASTA)	NCBI Sequence Viewer
	XP_063119905	(Get FASTA)	NCBI Sequence Viewer
	XP_063119906	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI58731	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005803.6

RefSeq Acc Id:

NP_001167029 ⟸ NM_001173558

- UniProtKB:

A6HR70 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKVKMLSRNPDNYVRETKLDIQRVPRNYDPTLHPFEVPREYVRALNATKLERVFAKPFLASLDG
HRDGVNCLAKHPKSLATVLSGACDGEVKIWNLTKRKCIRTIQAHEGFVRGICTRFCGTSFFTVG
DDKTVKQWKMDGPGCGEEEEPLYTVLGKTVYTGIDHHWKDPAFATCGQQVDIWDEQRTSPVCSM
NWGFDSISSVKFNPIETYLLGSCASDRNIVLYDMRQATPLKKVILDMRTNTICWNPMEAFNFTA
ANEDYNLYTFDMRALDTPVMVHLDHVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKSRSREVY
HTRRMQHVICVKWTSDSKYILCGSDEMNIRLWKANASEKLGVLTSRERAANDYNQKLKEKFQYH
PHVKRIARHRHLPKSIYSQIQEQRVMKEARRRKEMNRRKHSKPGSVPVVSERKKHVVAVVK

hide sequence

Ensembl Acc Id:

ENSRNOP00000005803 ⟸ ENSRNOT00000005803

RefSeq Acc Id:	XP_063119905 ⟸ XM_063263835
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063119906 ⟸ XM_063263836
- Peptide Label:	isoform X2

Protein Domains

Sof1-like protein

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1M7P1-F1-model_v2	AlphaFold	F1M7P1	1-445	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695307

Promoter ID:

EPDNEW_R5832

Type:

initiation region

Name:

Dcaf13_1

Description:

DDB1 and CUL4 associated factor 13

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	78,005,222 - 78,005,282	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308458	AgrOrtholog
BioCyc Gene	G2FUF-33575	BioCyc
Ensembl Genes	ENSRNOG00000004301	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000005803.7	UniProtKB/TrEMBL
Gene3D-CATH	2.130.10.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:9092184	IMAGE-MGC_LOAD
InterPro	Sof1	UniProtKB/TrEMBL
	WD40/YVTN_repeat-like_dom	UniProtKB/TrEMBL
	WD40_repeat	UniProtKB/TrEMBL
	WD40_repeat_dom_sf	UniProtKB/TrEMBL
	WD_repeat_DCAF13/WDSOF1	UniProtKB/TrEMBL
KEGG Report	rno:362902	UniProtKB/TrEMBL
MGC_CLONE	MGC:187887	IMAGE-MGC_LOAD
NCBI Gene	362902	ENTREZGENE
PANTHER	DDB1- AND CUL4-ASSOCIATED FACTOR 13	UniProtKB/TrEMBL
	U3 SMALL NUCLEOLAR RNA U3 SNORNA ASSOCIATED PROTEIN	UniProtKB/TrEMBL
Pfam	Sof1	UniProtKB/TrEMBL
	WD40	UniProtKB/TrEMBL
PhenoGen	Dcaf13	PhenoGen
PROSITE	WD_REPEATS_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000004301	RatGTEx
SMART	WD40	UniProtKB/TrEMBL
Superfamily-SCOP	WD40_like	UniProtKB/TrEMBL
UniProt	A6HR70	ENTREZGENE, UniProtKB/TrEMBL
	B0BN91_RAT	UniProtKB/TrEMBL
	F1M7P1_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2010-05-05	Dcaf13	DDB1 and CUL4 associated factor 13	Wdsof1	WD repeats and SOF1 domain containing	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-12-15	Wdsof1	WD repeats and SOF1 domain containing	Wdsof1	WD repeats and SOF domain containing 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Wdsof1	WD repeats and SOF domain containing 1	Wdsof1_predicted	WD repeats and SOF domain containing 1 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Wdsof1_predicted	WD repeats and SOF domain containing 1 (predicted)	Gm83_predicted	gene model 83, (NCBI) (predicted)	Symbol and Name updated	1299863	APPROVED
2005-01-12	Gm83_predicted	gene model 83, (NCBI) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar