Advanced Search (OLGA)

Gene: Calhm2 (calcium homeostasis modulator family member 2) Rattus norvegicus

Analyze

Symbol:

Calhm2

Name:

calcium homeostasis modulator family member 2

RGD ID:

1308276

Description:

Predicted to enable monoatomic cation channel activity. Predicted to be involved in several processes, including ATP export; calcium ion import; and regulation of microglial cell activation. Predicted to be located in membrane. Predicted to be active in plasma membrane. Orthologous to human CALHM2 (calcium homeostasis modulator family member 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

calcium homeostasis modulator 2; calcium homeostasis modulator protein 2; Fam26b; family with sequence similarity 26, member B; LOC294019; MGC105861; RGD1308276; similar to RIKEN cDNA 2810048G17 gene

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	255,963,661 - 255,969,387 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	255,963,663 - 255,969,387 (-)	Ensembl				GRCr8
mRatBN7.2	1	246,022,324 - 246,028,050 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	246,022,324 - 246,028,218 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	254,149,053 - 254,154,780 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	260,842,614 - 260,848,336 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	253,491,111 - 253,496,849 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	266,908,367 - 266,914,093 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	266,908,369 - 266,914,093 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	274,338,778 - 274,344,504 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	252,454,945 - 252,460,671 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	241,793,933 - 241,799,659 (-)	NCBI		Celera
RGSC_v3.1	1	252,719,519 - 252,725,244 (-)	NCBI
Cytogenetic Map	1	q54	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

dementia (ISS)

depressive disorder (ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

4,4'-sulfonyldiphenol (ISO)

5-azacytidine (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amphetamine (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

aspartame (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (EXP,ISO)

cadmium dichloride (ISO)

cisplatin (ISO)

DDT (EXP)

Dibutyl phosphate (ISO)

dioxygen (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

formaldehyde (ISO)

gentamycin (EXP)

GSK-J4 (ISO)

lidocaine (EXP)

lipopolysaccharide (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methamphetamine (EXP)

monosodium L-glutamate (ISO)

nickel atom (ISO)

nitrates (ISO)

ozone (EXP,ISO)

paracetamol (EXP)

pinostrobin (ISO)

pirinixic acid (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

selenium atom (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

Soman (EXP)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

ATP export (IEA,ISO,ISS)

calcium ion import (ISO,ISS)

monoatomic cation transmembrane transport (IEA)

monoatomic ion transmembrane transport (IEA)

monoatomic ion transport (IEA)

positive regulation of apoptotic process (ISO,ISS)

regulation of microglial cell activation (ISO,ISS)

regulation of synaptic plasticity (ISO,ISS)

Cellular Component

plasma membrane (IBA,IEA,ISO,ISS)

Molecular Function

monoatomic cation channel activity (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15489334	PMID:16751333

Genomics

Comparative Map Data

Calhm2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	255,963,661 - 255,969,387 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	255,963,663 - 255,969,387 (-)	Ensembl				GRCr8
mRatBN7.2	1	246,022,324 - 246,028,050 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	246,022,324 - 246,028,218 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	254,149,053 - 254,154,780 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	260,842,614 - 260,848,336 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	253,491,111 - 253,496,849 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	266,908,367 - 266,914,093 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	266,908,369 - 266,914,093 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	274,338,778 - 274,344,504 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	252,454,945 - 252,460,671 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	241,793,933 - 241,799,659 (-)	NCBI		Celera
RGSC_v3.1	1	252,719,519 - 252,725,244 (-)	NCBI
Cytogenetic Map	1	q54	NCBI

CALHM2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	103,446,786 - 103,452,370 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	103,446,784 - 103,452,780 (-)	Ensembl			hg38	GRCh38
GRCh37	10	105,206,543 - 105,212,127 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	105,196,536 - 105,202,065 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	105,196,538 - 105,202,065	NCBI
Celera	10	98,946,475 - 98,952,094 (-)	NCBI		Celera
Cytogenetic Map	10	q24.33	ENTREZGENE
HuRef	10	98,837,338 - 98,842,933 (-)	NCBI		HuRef
CHM1_1	10	105,490,660 - 105,496,279 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	10	104,334,092 - 104,339,676 (-)	NCBI		T2T-CHM13v2.0

Calhm2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	47,120,671 - 47,126,733 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	47,093,792 - 47,126,733 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	19	47,132,232 - 47,138,294 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	47,105,353 - 47,138,294 (-)	Ensembl			mm10	GRCm38
MGSCv37	19	47,206,722 - 47,212,784 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	19	47,185,550 - 47,191,605 (-)	NCBI		MGSCv36	mm8
Celera	19	47,901,500 - 47,907,603 (-)	NCBI		Celera
Cytogenetic Map	19	C3	NCBI
cM Map	19	39.28	NCBI

Calhm2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955485	7,106,926 - 7,113,249 (+)	Ensembl
ChiLan1.0	NW_004955485	7,106,926 - 7,111,745 (+)	NCBI	ChiLan1.0	ChiLan1.0

CALHM2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	115,330,822 - 115,336,465 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	115,336,151 - 115,339,319 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	100,044,254 - 100,049,892 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	103,505,252 - 103,511,090 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	103,505,252 - 103,511,097 (-)	Ensembl			panPan2	panpan1.1

CALHM2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	28	15,813,891 - 15,818,754 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	28	15,814,429 - 15,825,924 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	28	15,985,771 - 15,992,049 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	28	16,290,048 - 16,296,318 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	28	16,290,589 - 16,301,471 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	28	15,839,045 - 15,845,321 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	28	15,866,887 - 15,873,157 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	28	16,005,491 - 16,011,769 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Calhm2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	31,022,175 - 31,027,294 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936600	2,625,552 - 2,632,479 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936600	2,625,601 - 2,631,211 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CALHM2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	96,493,807 - 96,499,892 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	96,493,488 - 96,499,358 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666048	57,610,058 - 57,616,837 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Calhm2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624831	2,673,753 - 2,680,083 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624831	2,673,753 - 2,679,024 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Calhm2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	46,663,967 - 46,669,732 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Calhm2
32 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	85
Count of miRNA genes:	66
Interacting mature miRNAs:	76
Transcripts:	ENSRNOT00000027526
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	160111531	262090437	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	266453731	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	186658830	266453731	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	210980612	255980612	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	226175591	270518180	Rat
1578775	Iddm21	Insulin dependent diabetes mellitus QTL 21	4.13		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	245782829	270518180	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	205233991	267096252	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	218829748	263829748	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	186658830	266453731	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
631837	Niddm35	Non-insulin dependent diabetes mellitus QTL 35		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	248619887	269633915	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	176288899	270518180	Rat
631836	Stl31	Serum triglyceride level QTL 31	4.64	5e-06	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	247133834	270518180	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	162548015	270518180	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	210980612	255980612	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	152919152	268496042	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	160111531	262090437	Rat
1300108	Rf8	Renal function QTL 8	3.75		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	1	237995023	269633915	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	233480549	270108840	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	200449456	256003563	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	234540191	270518180	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	233480549	270108840	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	207163993	269633915	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	210980612	255980612	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	223134011	262090599	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	210980612	255980612	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	160111426	262090599	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	225108840	270108840	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	228180370	266453608	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	154961463	266453731	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	208479811	269633915	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	224633915	269633915	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	232312773	270518180	Rat
1358916	Kidm22	Kidney mass QTL 22	3.32		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	212738576	257738576	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	194786607	262083703	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
2293700	Bmd27	Bone mineral density QTL 27	6.6	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	210980612	255980612	Rat
2293701	Bmd34	Bone mineral density QTL 34	8.3	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	1	210980612	255980612	Rat
7387289	Uae45	Urinary albumin excretion QTL 45	2.86	0.0021	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	233204160	270518180	Rat
1598839	Rf56	Renal function QTL 56			renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	255849111	270518180	Rat
1581544	Rf52	Renal function QTL 52		0.05	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	1	241569529	269633915	Rat
1600363	Hc6	Hypercalciuria QTL 6	2.7		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	210980612	255980612	Rat
631536	Lnnr2	Liver neoplastic nodule remodeling QTL 2	2.9	0.0005	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	1	243953669	270518180	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	185857683	270518180	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	226175591	270518180	Rat
631669	Iddm9	Insulin dependent diabetes mellitus QTL 9	2.8	0.039	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	233349180	270518180	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	210980612	255980612	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	228174566	270518180	Rat

Markers in Region

RH141199

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	246,022,382 - 246,022,585 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	266,908,426 - 266,908,628	NCBI	Rnor6.0
Rnor_5.0	1	274,338,837 - 274,339,039	UniSTS	Rnor5.0
RGSC_v3.4	1	252,455,004 - 252,455,206	UniSTS	RGSC3.4
Celera	1	241,793,992 - 241,794,194	UniSTS
Cytogenetic Map	1	q54	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	162	91	90	59	92	59	6	356	192	11	141	81	92	31	15	15

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001008306	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC112451	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC086540	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000027526 ⟹ ENSRNOP00000027526

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	255,963,663 - 255,969,387 (-)	Ensembl
mRatBN7.2 Ensembl	1	246,022,324 - 246,028,218 (-)	Ensembl
Rnor_6.0 Ensembl	1	266,908,369 - 266,914,093 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000127575 ⟹ ENSRNOP00000107652

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	255,963,663 - 255,968,451 (-)	Ensembl

RefSeq Acc Id:

NM_001008306 ⟹ NP_001008307

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	255,963,661 - 255,969,387 (-)	NCBI
mRatBN7.2	1	246,022,324 - 246,028,050 (-)	NCBI
Rnor_6.0	1	266,908,367 - 266,914,093 (-)	NCBI
Rnor_5.0	1	274,338,778 - 274,344,504 (-)	NCBI
RGSC_v3.4	1	252,454,945 - 252,460,671 (-)	RGD
Celera	1	241,793,933 - 241,799,659 (-)	RGD

Sequence:

show sequence

CGAATTAAGTTTGTTTGTAACTGGGCCCAAAGCTCTGTTGCTTTCAAACGCTGGGCCCTGGCCC
CTGGTACAAAAGCAAAGCCGGCCCGTGAACCCCGTGAGGCCACTTTGCCTTGCGGGTCAGGAGC
GCCTTTCCAGTGTCTGCGGGAGCCTACTCTGCTGTCACTCCATCAGGAAGCCAAGGCCACGGGT
GCCTGCAACCAGCCCTAGAAAGCACCAGTTCCGACACTGCCTGAGATAAAATGGCGTAATCATG
CTCTGCCTTCGGATGCCCTCCCGTCTACGCTCCTGGCTAGTCTCACCAGAAGCCATCAGTTCTG
CCCTCTTCTGCCACCTCCGAAGCATCCCATCCCTGGCCCTCCAGTCACCATGGCAGCCTTGATT
GCAGAGAACTTCCGCTTCCTGTCTCTCTTCTTCAAGAGCAAGGATGTCATGATTTTCAACGGGC
TGGTGGCCCTGGGCACGGTGGGCAGTCAGGAGCTGTTCTCAGTGGTGGCCTTCCACTGTCCCTG
CTCACCTGCCCGGAACTACCTGTATGGGCTGACAGCCATTGGTGTGCCTGCGCTGGCACTCTTC
CTCATTGGAGTCATCCTCAACAACCACACTTGGAACCTAGTTGCTGAGTGCCAGTACCGGAGGG
CCAAGAACTGTTCTGCTGCCCCCACCTTCCTCCTCCTAAGTTCTATCCTGGGCCGTGCAGCCGT
GGCCCCAGTCACCTGGTCTGTTATCTCCCTGCTTCGAGGGGAGGCCTACGTCTGTGCACTCAGT
GAGTTTGTGGACCCCTCCTCGCTCACGGCTGGGGATGAAGGTTTCCCCCCAGACCATGCCACAG
AGATCTTAGCCAGGTTCCCTTGCGGAGAGGGCCCTGCCAACCTATCGGGCTTCCGAGAGGAGGT
CAGCCGCAGGCTCAAGTATGAGTCCCAGCTCTTTGGATGGCTGCTCATCGGCGTGGTGGCCATC
CTGGTGTTCCTGACCAAGTGCTTCAAGCATTACTGCTCACCGCTCAGCTACCGCCAGGAGGCCT
ACTGGGCGCAGTACCGCACCAACGAGGACCAGCTGTTCCAGCGCACGGCAGAGGTGCATTCGAG
GGTGCTGGCCGCCAACAACGTGCGCCGTTTCTTTGGCTTCGTGGCTCTCAACAAGGATGACGAA
GAGCTGGTCACCAAGTTCCCGGTGGAAGGCACACAGCCACGGCCACAGTGGAACGCTATCACCG
GGGTCTATTTGTACCGCGAGAACCAGGGCCTCCCACTCTATAGTCGCTTACACAAGTGGGCCCA
GGGCCTGACGGGTAATGGCACAGCCCCTGACAATGTAGAGATGGCCCTGCTCACTGTCTAAGAG
CCTACTTCTATGCCCTCTGTAAGTGGAACTATTGAGTCTCAAACCAACCCCTCGTGGCATGCTC
ACTTTTGCATCAGGTGACTTTCCCGTTAACTACGGTGTCTTGGGCATAGACAAAAACAACTAAT
GGTTTGTAAAGATCCCGTGGACCACATGGTGGGGTGGGAGCGGGGACTGGCCTACCAAAATCAT
CTCTCCTGTGGCCACAAGCACACTCTGTTCACAGTTCTGGGACTTTCCTAGAGCTGGCCCTTAG
TATGACAGGAGTGATCTTTGGTGGGCCTCAGAGTTGGGAAACATCAGCCGGTGAGGCCTGGTGG
CAACCCACTAGGGCTACTCGTCCTTGTATAGTACTGTGCTGTTAATTTGTGTGTAATCGAGTCA
GGACACCTAGCTCCTCGGTGTACTGCTAGGAAGCTGCCTCAATTGTATACCTCTGGCTTGATTT
TATATATTTAAACTTTTTGATAAAGCTTTTCTTACTTTTAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001008307	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH86540	(Get FASTA)	NCBI Sequence Viewer
	EDL94372	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000027526
	ENSRNOP00000027526.3
GenBank Protein	Q5RJQ8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001008307 ⟸ NM_001008306

- UniProtKB:

Q5RJQ8 (UniProtKB/Swiss-Prot), A6JHP8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAALIAENFRFLSLFFKSKDVMIFNGLVALGTVGSQELFSVVAFHCPCSPARNYLYGLTAIGVP
ALALFLIGVILNNHTWNLVAECQYRRAKNCSAAPTFLLLSSILGRAAVAPVTWSVISLLRGEAY
VCALSEFVDPSSLTAGDEGFPPDHATEILARFPCGEGPANLSGFREEVSRRLKYESQLFGWLLI
GVVAILVFLTKCFKHYCSPLSYRQEAYWAQYRTNEDQLFQRTAEVHSRVLAANNVRRFFGFVAL
NKDDEELVTKFPVEGTQPRPQWNAITGVYLYRENQGLPLYSRLHKWAQGLTGNGTAPDNVEMAL
LTV

hide sequence

Ensembl Acc Id:

ENSRNOP00000027526 ⟸ ENSRNOT00000027526

Ensembl Acc Id:

ENSRNOP00000107652 ⟸ ENSRNOT00000127575

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5RJQ8-F1-model_v2	AlphaFold	Q5RJQ8	1-323	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308276	AgrOrtholog
BioCyc Gene	G2FUF-55489	BioCyc
Ensembl Genes	ENSRNOG00000020325	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000027526	ENTREZGENE
	ENSRNOT00000027526.4	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7122173	IMAGE-MGC_LOAD
InterPro	CALHM	UniProtKB/Swiss-Prot
KEGG Report	rno:294019	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105861	IMAGE-MGC_LOAD
NCBI Gene	294019	ENTREZGENE
PANTHER	PTHR32261	UniProtKB/Swiss-Prot
	PTHR32261:SF3	UniProtKB/Swiss-Prot
Pfam	Ca_hom_mod	UniProtKB/Swiss-Prot
PhenoGen	Calhm2	PhenoGen
RatGTEx	ENSRNOG00000020325	RatGTEx
UniProt	A0ABK0LRH2_RAT	UniProtKB/TrEMBL
	A6JHP8	ENTREZGENE, UniProtKB/TrEMBL
	CAHM2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-07-31	Calhm2	calcium homeostasis modulator family member 2	Calhm2	calcium homeostasis modulator 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-10-10	Calhm2	calcium homeostasis modulator 2	Fam26b	family with sequence similarity 26, member B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Fam26b	family with sequence similarity 26, member B	RGD1308276	similar to RIKEN cDNA 2810048G17 gene	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	RGD1308276	similar to RIKEN cDNA 2810048G17 gene	Fam26b	family with sequence similarity 26, member B	Symbol and Name updated	1299863	APPROVED
2005-12-06	Fam26b	family with sequence similarity 26, member B	Fam26b_predicted	family with sequence similarity 26, member B (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Fam26b_predicted	family with sequence similarity 26, member B (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - MGI