Shoc2 (SHOC2 leucine-rich repeat scaffold protein)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Community Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease Coronavirus Disease Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Shoc2 (SHOC2 leucine-rich repeat scaffold protein) Rattus norvegicus

Analyze

Symbol:

Shoc2

Name:

SHOC2 leucine-rich repeat scaffold protein

RGD ID:

1308146

Description:

Predicted to enable protein phosphatase 1 binding activity. Involved in several processes, including cellular response to growth hormone stimulus; nerve growth factor signaling pathway; and regulation of neuron differentiation. Predicted to be located in cytosol and nucleoplasm. Predicted to be part of protein phosphatase type 1 complex. Human ortholog(s) of this gene implicated in Noonan syndrome-like disorder with loose anagen hair 1 and atopic dermatitis. Orthologous to human SHOC2 (SHOC2 leucine rich repeat scaffold protein); INTERACTS WITH bisphenol A; ketamine; rotenone.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

leucine-rich repeat protein SHOC-2; LOC309548; protein soc-2 homolog; protein sur-8 homolog; soc-2 (suppressor of clear) homolog; soc-2 (suppressor of clear) homolog (C. elegans); soc-2 suppressor of clear homolog; soc-2 suppressor of clear homolog (C. elegans)

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SHOC2 (SHOC2 leucine rich repeat scaffold protein)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, PhylomeDB
Mus musculus (house mouse):	Shoc2 (Shoc2, leucine rich repeat scaffold protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Shoc2 (SHOC2 leucine rich repeat scaffold protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SHOC2 (SHOC2 leucine rich repeat scaffold protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SHOC2 (SHOC2 leucine rich repeat scaffold protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Shoc2 (SHOC2 leucine rich repeat scaffold protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SHOC2 (SHOC2 leucine rich repeat scaffold protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SHOC2 (SHOC2 leucine rich repeat scaffold protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Shoc2 (SHOC2 leucine rich repeat scaffold protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SHOC2 (SHOC2 leucine rich repeat scaffold protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Shoc2 (Shoc2, leucine rich repeat scaffold protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	shoc2 (SHOC2 leucine rich repeat scaffold protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Sur-8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	soc-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	shoc2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Is Marker For:

Strains: F344.GK-(D1Swe8-D1Gpam-1)/Swe

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	252,958,939 - 253,048,820 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	252,959,723 - 253,047,337 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	261,185,439 - 261,235,437 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	267,891,515 - 267,941,516 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	260,546,911 - 260,597,396 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	274,700,621 - 274,751,195 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	274,688,580 - 274,751,816 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	282,112,968 - 282,163,542 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	260,255,253 - 260,273,170 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	260,429,356 - 260,484,216 (+)	NCBI
Celera	1	248,709,991 - 248,759,976 (+)	NCBI		Celera
Cytogenetic Map	1	q55	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

atopic dermatitis (ISO)

autosomal recessive polycystic kidney disease (ISO)

Cornelia de Lange syndrome 3 (ISO)

dilated cardiomyopathy 1DD (ISO)

familial hypertrophic cardiomyopathy (ISO)

Funnel Chest (ISO)

genetic disease (ISO)

hair disease (ISO)

Hydrops Fetalis (ISO)

intellectual disability (ISO)

Intracranial Hemorrhages (IEP)

Noonan syndrome (ISO)

Noonan syndrome 3 (ISO)

Noonan syndrome-like disorder with loose anagen hair (ISO)

Noonan syndrome-like disorder with loose anagen hair 1 (ISO)

polycystic kidney disease 3 (ISO)

polycystic kidney disease 4 (ISO)

RASopathy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxynon-2-enal (ISO)

aflatoxin B1 (ISO)

aristolochic acid A (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

clorgyline (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

dicrotophos (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

folic acid (ISO)

hydrogen peroxide (ISO)

ivermectin (ISO)

ketamine (EXP)

paracetamol (ISO)

paraquat (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

potassium dichromate (ISO)

rotenone (EXP)

sodium arsenate (ISO)

sodium arsenite (ISO)

thimerosal (ISO)

thioacetamide (EXP)

trichloroethene (EXP)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to growth hormone stimulus (IEP)

negative regulation of neural precursor cell proliferation (IMP)

negative regulation of neuron differentiation (IMP)

nerve growth factor signaling pathway (IMP)

positive regulation of neuron differentiation (IMP)

positive regulation of neuron projection development (IMP)

positive regulation of Ras protein signal transduction (ISO,ISS)

signal transduction (IBA)

Cellular Component

cytoplasm (ISO,ISS)

cytosol (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (ISO,ISS)

protein phosphatase type 1 complex (ISO,ISS)

Molecular Function

protein binding (ISO)

protein phosphatase 1 binding (IBA,ISO)

protein phosphatase binding (ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Expanding the SHOC2 mutation associated phenotype of Noonan syndrome with loose anagen hair: structural brain anomalies and myelofibrosis.	Gripp KW, etal., Am J Med Genet A. 2013 Oct;161A(10):2420-30. doi: 10.1002/ajmg.a.36098. Epub 2013 Aug 5.
4.	Mutation analysis of the SHOC2 gene in Noonan-like syndrome and in hematologic malignancies.	Komatsuzaki S, etal., J Hum Genet. 2010 Dec;55(12):801-9. doi: 10.1038/jhg.2010.116. Epub 2010 Sep 30.
5.	Shoc2/Sur8 protein regulates neurite outgrowth.	Leon G, etal., PLoS One. 2014 Dec 16;9(12):e114837. doi: 10.1371/journal.pone.0114837. eCollection 2014.
6.	Suppressor of cytokine signaling-2: a growth hormone-inducible inhibitor of intestinal epithelial cell proliferation.	Miller ME, etal., Gastroenterology. 2004 Aug;127(2):570-81. doi: 10.1053/j.gastro.2004.05.016.
7.	Sur8/Shoc2 involves both inhibition of differentiation and maintenance of self-renewal of neural progenitor cells via modulation of extracellular signal-regulated kinase signaling.	Moon BS, etal., Stem Cells. 2011 Feb;29(2):320-31. doi: 10.1002/stem.586.
8.	Expanding the molecular spectrum of pathogenic SHOC2 variants underlying Mazzanti syndrome.	Motta M, etal., Hum Mol Genet. 2022 Aug 23;31(16):2766-2778. doi: 10.1093/hmg/ddac071.
9.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
14.	Study of the pathology and the underlying molecular mechanism of tissue injury around hematoma following intracerebral hemorrhage.	Wang J, etal., Mol Med Rep. 2021 Oct;24(4):702. doi: 10.3892/mmr.2021.12341. Epub 2021 Aug 9.

Additional References at PubMed

PMID:16630891	PMID:19684605	PMID:25137548	PMID:25931508

Genomics

Comparative Map Data

Shoc2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	252,958,939 - 253,048,820 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	252,959,723 - 253,047,337 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	261,185,439 - 261,235,437 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	267,891,515 - 267,941,516 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	260,546,911 - 260,597,396 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	274,700,621 - 274,751,195 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	274,688,580 - 274,751,816 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	282,112,968 - 282,163,542 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	260,255,253 - 260,273,170 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	260,429,356 - 260,484,216 (+)	NCBI
Celera	1	248,709,991 - 248,759,976 (+)	NCBI		Celera
Cytogenetic Map	1	q55	NCBI

SHOC2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	110,919,370 - 111,013,665 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	110,919,367 - 111,017,307 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	112,679,128 - 112,773,423 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	112,713,903 - 112,763,413 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	112,713,902 - 112,763,412	NCBI
Celera	10	106,410,898 - 106,505,011 (+)	NCBI		Celera
Cytogenetic Map	10	q25.2	NCBI
HuRef	10	106,308,147 - 106,402,174 (+)	NCBI		HuRef
CHM1_1	10	112,961,089 - 113,055,240 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	111,803,149 - 111,897,478 (+)	NCBI		T2T-CHM13v2.0

Shoc2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	53,932,018 - 54,021,711 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	53,932,737 - 54,021,564 (+)	Ensembl		GRCm39 Ensembl
GRCm38	19	53,944,232 - 54,033,280 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	53,944,306 - 54,033,133 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	54,018,796 - 54,107,768 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	53,997,618 - 54,086,179 (+)	NCBI		MGSCv36	mm8
Celera	19	56,139,278 - 56,228,071 (+)	NCBI		Celera
Cytogenetic Map	19	D2	NCBI
cM Map	19	48.83	NCBI

Shoc2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955485	430,493 - 517,126 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955485	430,493 - 517,767 (-)	NCBI	ChiLan1.0	ChiLan1.0

SHOC2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	10	122,805,689 - 122,899,485 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	107,512,795 - 107,606,627 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	110,961,764 - 111,055,312 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	110,993,556 - 111,055,312 (+)	Ensembl	panpan1.1		panPan2

SHOC2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	28	22,241,886 - 22,338,418 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	28	22,285,125 - 22,336,545 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	28	22,393,960 - 22,490,541 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	28	22,766,445 - 22,863,097 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	28	22,767,302 - 22,863,077 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	28	22,325,648 - 22,422,221 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	28	22,332,434 - 22,429,036 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	28	22,466,604 - 22,563,246 (+)	NCBI		UU_Cfam_GSD_1.0

Shoc2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	23,751,857 - 23,837,883 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936486	1,723,253 - 1,809,416 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SHOC2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	121,349,059 - 121,444,136 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	121,347,938 - 121,444,144 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	132,275,134 - 132,378,299 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SHOC2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	103,857,229 - 103,954,724 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	103,857,218 - 103,956,602 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	65,062,876 - 65,154,464 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Shoc2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624737	35,319,767 - 35,401,044 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624737	35,318,263 - 35,401,787 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Shoc2
201 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	123
Count of miRNA genes:	100
Interacting mature miRNAs:	109
Transcripts:	ENSRNOT00000020580
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	199050459	259647894	Rat
1358890	Bp259	Blood pressure QTL 259	3.06		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	210702053	260522016	Rat
734768	Niddm59	Non-insulin dependent diabetes mellitus QTL 59			body mass (VT:0001259)	body weight (CMO:0000012)	1	213843987	258843987	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	214647894	259647894	Rat
1549910	Bw54	Body weight QTL 54		0.05	body mass (VT:0001259)	body weight (CMO:0000012)	1	214647894	259647894	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	216255568	260522016	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	216255568	260522016	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	218748008	257976495	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	218753816	256448513	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	221264111	259647894	Rat
10053715	Scort24	Serum corticosterone level QTL 24	2.13	0.0088	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	221414816	260522016	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	222363780	260522016	Rat
1600392	Bw123	Body weight QTL 123		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	223201027	260522016	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	224054293	260122809	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	224054293	260122809	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	224569538	260122809	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	225126575	260522016	Rat
1300108	Rf8	Renal function QTL 8	3.75		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	1	228581588	259647894	Rat
1581544	Rf52	Renal function QTL 52		0.05	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	1	232156370	259647894	Rat
631669	Iddm9	Insulin dependent diabetes mellitus QTL 9	2.8	0.039	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	233190394	258625266	Rat
631536	Lnnr2	Liver neoplastic nodule remodeling QTL 2	2.9	0.0005	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	1	233948574	260522016	Rat
631690	Scl5	Serum cholesterol level QTL 5	2.1		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	236125214	260522016	Rat
631836	Stl31	Serum triglyceride level QTL 31	4.64	0.00000487	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	237147813	260522016	Rat
631837	Niddm35	Non-insulin dependent diabetes mellitus QTL 35		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	238699859	259647894	Rat
1598839	Rf56	Renal function QTL 56			renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	245907761	257976495	Rat
1600384	Niddm66	Non-insulin dependent diabetes mellitus QTL 66		0.000005	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	252645447	253439819	Rat

Markers in Region

BE107930

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	252,998,768 - 252,998,981 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	274,703,392 - 274,703,604	NCBI	Rnor6.0
Rnor_5.0	1	282,115,739 - 282,115,951	UniSTS	Rnor5.0
RGSC_v3.4	1	260,258,024 - 260,258,236	UniSTS	RGSC3.4
Celera	1	248,712,762 - 248,712,974	UniSTS
RH 3.4 Map	1	1674.1	UniSTS
Cytogenetic Map	1	q55	UniSTS

Related Rat Strains

The following Strains have been annotated to Shoc2

F344.GK-(D1Swe8-D1Gpam-1)/Swe

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	40	48	32	19	32	8	10	74	35	41	11	8
Low		3	9	9		9		1
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013155	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039080752	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039080757	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039080768	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039080777	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039080784	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039080785	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039080788	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039080789	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC098942	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079032	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000054	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000020580 ⟹ ENSRNOP00000020580

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	252,959,723 - 253,047,337 (+)	Ensembl
Rnor_6.0 Ensembl	1	274,688,580 - 274,751,816 (+)	Ensembl

RefSeq Acc Id:

NM_001013155 ⟹ NP_001013173

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	252,995,998 - 253,045,969 (+)	NCBI
Rnor_6.0	1	274,700,621 - 274,751,195 (+)	NCBI
Rnor_5.0	1	282,112,968 - 282,163,542 (+)	NCBI
RGSC_v3.4	1	260,255,253 - 260,273,170 (+)	RGD
Celera	1	248,709,991 - 248,759,976 (+)	RGD

Sequence:

show sequence

CGGAGGACGAGGAGGAGGAAGGAGGAATCCTAATGAACTGACCAGCAGCATTTTCACAAGTTGA
AATGAACAGAGAGCTTTTAGAGCCAACATGTAACAGATGGATGTGAGCCCAAGGCCATCATCTT
CATGCCGACACTCTTGACTGGGTAGGATCTGTCTCTTCATCTTTGATCTGGATTGCTGGCAAAT
AAAAGGAGTTCATGTAGTGTTTTAGTTAAGCTTGAGTCACCATGAGTAGTAGTTTAGGAAAAGA
AAAAGACTCGAAAGAGAAAGATCCCAAAGTACCATCTGCCAAGGAAAGAGAAAAGGAGGCAAAA
GCCTCTGGAGGTTTTGGGAAAGAAAGCAAAGAAAAAGAACCTAAAACCAAAGGGAAAGATGCCA
AAGATGGAAAGAAGGAGTCCAGTGCTGCCCAACCTGGTGTGGCTTTTTCAGTCGACAATACCAT
CAAACGGCCTAATCCAGCACTTGGGACTAGAAAGAAATCCAGCAATGCCGAGGTAACTAAGGAG
CTTAACAAATGCCGGGAGGAGAACTCAATGCGCTTGGACTTATCCAAGCGGTCTATACATATAC
TGCCGCCGTCAGTCAAAGAGTTGACACAACTCACGGAACTTTATTTATACAGTAACAAATTGCA
GTCCCTCCCAGCAGAGGTGGGCTGTCTAGTCAATCTTATGACGCTGGCTCTCAGTGAGAATTCA
CTCACCAGTTTGCCTGACTCTCTCGATAACTTGAAGAAGCTGCGGATGCTTGATTTACGGCATA
ATAAACTGAGAGAAATCCCTTCGGTGGTGTACAGGCTAGACTCCCTGACTACTCTCTACCTTCG
CTTTAACCGCATAACCGCTGTGGAGAAGGACGTCAGAAACCTGCCGAGGCTCAGCACGCTTAGC
ATCCGAGAGAACAAAATCAAGCAGCTCCCTGCCGAGATCGGTGAACTGTGTAACCTCATTACCC
TGGATGTAGCTCACAATCAACTTGAACACCTTCCGAAGGAGATTGGGAACTGCACCCAGATAAC
CAACCTGGACCTGCAGCACAATGAGCTGCTAGACCTCCCAGACACAATAGGAAACCTGTCCAGT
TTAAATCGCCTTGGCCTGAGGTACAATAGATTGTCAGCAATACCCAGATCATTAGCAAAATGCA
GCGCACTTGAGGAGCTAAATCTAGAGAACAATAACATTTCTACTCTGCCAGAGAGTCTTTTATC
CAGTCTTGTAAAATTGAATAGCTTGACCTTAGCTAGAAATTGCTTCCAGTTGTACCCAGTGGGA
GGCCCATCTCAGTTTTCCACCATTTATTCCCTCAACATGGAACACAATCGAATCAACAAAATCC
CATTTGGAATTTTTTCCAGAGCTAAAGTGCTGAGTAAGCTGAATATGAAGGACAATCAGTTAAC
ATCACTTCCTTTGGATTTTGGAACTTGGACCAGTATGGTAGAATTGAATTTAGCGACCAATCAG
CTCACAAAGATCCCGGAGGACGTGTCTGGTCTTGTTTCTCTTGAGGTTCTAATATTATCGAACA
ATCTTCTAAAGAAGCTTCCCCATGGTCTTGGAAACCTTAGAAAGTTACGAGAATTAGACCTGGA
GGAGAACAAGCTGGAGTCCTTGCCCAATGAGATTGCTTATCTTAAGGATTTACAGAAATTAGTC
TTGACAAACAACCAGTTGACCACTCTCCCCAGAGGCATCGGTCACCTTACCAACCTCACACACC
TTGGTCTCGGAGAGAACCTTCTCACTCACCTTCCTGAGGAAATTGGTACACTGGAAAACCTAGA
GGAGCTGTACTTGAATGACAACCCCAACCTTCACAGCCTCCCCTTCGAGCTTGCCCTCTGCAGC
AAGCTGTCAATCATGAGTATTGAGAACTGTCCACTCAGTCACCTCCCACCTCAAATTGTTGCTG
GAGGGCCTTCATTCATTATTCAGTTCTTAAAGATGCAGGGTCCGTATCGTGCCATGGTCTGATA
CAAACTGCTGGTCCCATACACTGTTCAAAATAGACTGCCATTACTCTTTGGTATCTGTATCTGT
GTCTGTGTGGATATCGATCTATGGCAGACTTATAAAGACTGCATTATGTGTTTCTGCTAATAGA
GGAATCATAGCCATTTAGATTTTTTTAATTCTGTAAAAAAAAAAAGGCTTAATAAAAAAAAAAA
AAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039080752 ⟹ XP_038936680

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	252,959,760 - 253,048,820 (+)	NCBI

RefSeq Acc Id:

XM_039080757 ⟹ XP_038936685

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	252,959,044 - 253,047,753 (+)	NCBI

RefSeq Acc Id:

XM_039080768 ⟹ XP_038936696

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	252,959,736 - 253,048,820 (+)	NCBI

RefSeq Acc Id:

XM_039080777 ⟹ XP_038936705

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	252,959,760 - 253,048,820 (+)	NCBI

RefSeq Acc Id:

XM_039080784 ⟹ XP_038936712

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	252,958,939 - 253,048,820 (+)	NCBI

RefSeq Acc Id:

XM_039080785 ⟹ XP_038936713

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	252,959,150 - 253,047,753 (+)	NCBI

RefSeq Acc Id:

XM_039080788 ⟹ XP_038936716

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	252,959,740 - 253,048,820 (+)	NCBI

RefSeq Acc Id:

XM_039080789 ⟹ XP_038936717

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	252,963,853 - 253,048,820 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001013173	(Get FASTA)	NCBI Sequence Viewer
	XP_038936680	(Get FASTA)	NCBI Sequence Viewer
	XP_038936685	(Get FASTA)	NCBI Sequence Viewer
	XP_038936696	(Get FASTA)	NCBI Sequence Viewer
	XP_038936705	(Get FASTA)	NCBI Sequence Viewer
	XP_038936712	(Get FASTA)	NCBI Sequence Viewer
	XP_038936713	(Get FASTA)	NCBI Sequence Viewer
	XP_038936716	(Get FASTA)	NCBI Sequence Viewer
	XP_038936717	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79032	(Get FASTA)	NCBI Sequence Viewer
	EDL94446	(Get FASTA)	NCBI Sequence Viewer
	EDL94447	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000020580
GenBank Protein	Q6AYI5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001013173 ⟸ NM_001013155

- UniProtKB:

Q6AYI5 (UniProtKB/Swiss-Prot), A6JHX2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSSSLGKEKDSKEKDPKVPSAKEREKEAKASGGFGKESKEKEPKTKGKDAKDGKKESSAAQPGV
AFSVDNTIKRPNPALGTRKKSSNAEVTKELNKCREENSMRLDLSKRSIHILPPSVKELTQLTEL
YLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLD
SLTTLYLRFNRITAVEKDVRNLPRLSTLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKE
IGNCTQITNLDLQHNELLDLPDTIGNLSSLNRLGLRYNRLSAIPRSLAKCSALEELNLENNNIS
TLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKL
NMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLR
KLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEE
IGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLKMQG
PYRAMV

hide sequence

RefSeq Acc Id:

ENSRNOP00000020580 ⟸ ENSRNOT00000020580

RefSeq Acc Id:	XP_038936712 ⟸ XM_039080784
- Peptide Label:	isoform X1
- UniProtKB:	Q6AYI5 (UniProtKB/Swiss-Prot), A6JHX2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038936685 ⟸ XM_039080757
- Peptide Label:	isoform X1
- UniProtKB:	Q6AYI5 (UniProtKB/Swiss-Prot), A6JHX2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038936713 ⟸ XM_039080785
- Peptide Label:	isoform X1
- UniProtKB:	Q6AYI5 (UniProtKB/Swiss-Prot), A6JHX2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038936696 ⟸ XM_039080768
- Peptide Label:	isoform X1
- UniProtKB:	Q6AYI5 (UniProtKB/Swiss-Prot), A6JHX2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038936716 ⟸ XM_039080788
- Peptide Label:	isoform X1
- UniProtKB:	Q6AYI5 (UniProtKB/Swiss-Prot), A6JHX2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038936680 ⟸ XM_039080752
- Peptide Label:	isoform X1
- UniProtKB:	Q6AYI5 (UniProtKB/Swiss-Prot), A6JHX2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038936705 ⟸ XM_039080777
- Peptide Label:	isoform X1
- UniProtKB:	Q6AYI5 (UniProtKB/Swiss-Prot), A6JHX2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038936717 ⟸ XM_039080789
- Peptide Label:	isoform X1
- UniProtKB:	Q6AYI5 (UniProtKB/Swiss-Prot), A6JHX2 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AYI5-F1-model_v2	AlphaFold	Q6AYI5	1-582	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308146	AgrOrtholog
BioCyc Gene	G2FUF-55374	BioCyc
Ensembl Genes	ENSRNOG00000015339	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000020580	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	3.80.10.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7114263	IMAGE-MGC_LOAD
InterPro	Leu-rich_rpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Leu-rich_rpt_typical-subtyp	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	LRR_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:309548	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93960	IMAGE-MGC_LOAD
NCBI Gene	309548	ENTREZGENE
PANTHER	NON-SPECIFIC SERINE/THREONINE PROTEIN KINASE-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR48051	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	LRR_8	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Shoc2	PhenoGen
PROSITE	LRR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000015339	RatGTEx
SMART	LRR_BAC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	LRR_SD22	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	LRR_TYP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	L domain-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6JHX2	ENTREZGENE, UniProtKB/TrEMBL
	A6JHX3_RAT	UniProtKB/TrEMBL
	Q6AYI5	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-06-26	Shoc2	SHOC2 leucine-rich repeat scaffold protein	Shoc2	soc-2 suppressor of clear homolog (C. elegans)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-11-19	Shoc2	soc-2 suppressor of clear homolog (C. elegans)	Shoc2	soc-2 (suppressor of clear) homolog (C. elegans)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Shoc2	soc-2 (suppressor of clear) homolog (C. elegans)	Shoc2_predicted	soc-2 (suppressor of clear) homolog (C. elegans) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Shoc2_predicted	soc-2 (suppressor of clear) homolog (C. elegans) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM