Advanced Search (OLGA)

Gene: Mri1 (methylthioribose-1-phosphate isomerase 1) Rattus norvegicus

Analyze

Symbol:

Mri1

Name:

methylthioribose-1-phosphate isomerase 1

RGD ID:

1307789

Description:

Predicted to enable S-methyl-5-thioribose-1-phosphate isomerase activity and identical protein binding activity. Predicted to be involved in L-methionine salvage from methylthioadenosine. Predicted to be located in cytosol; fibrillar center; and nucleoplasm. Orthologous to human MRI1 (methylthioribose-1-phosphate isomerase 1); PARTICIPATES IN cysteine and methionine metabolic pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; endosulfan; flutamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC288912; M1Pi; methylthioribose-1-phosphate isomerase; methylthioribose-1-phosphate isomerase homolog; methylthioribose-1-phosphate isomerase homolog (S. cerevisiae); MGC105780; MTR-1-P isomerase; RGD1307789; S-methyl-5-thioribose-1-phosphate isomerase; similar to hypothetical protein MGC3207; translation initiation factor eIF-2B subunit alpha/beta/delta-like protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MRI1 (methylthioribose-1-phosphate isomerase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Mri1 (methylthioribose-1-phosphate isomerase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mri1 (methylthioribose-1-phosphate isomerase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MRI1 (methylthioribose-1-phosphate isomerase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MRI1 (methylthioribose-1-phosphate isomerase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mri1 (methylthioribose-1-phosphate isomerase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MRI1 (methylthioribose-1-phosphate isomerase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MRI1 (methylthioribose-1-phosphate isomerase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mri1 (methylthioribose-1-phosphate isomerase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Mri1 (methylthioribose-1-phosphate isomerase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	MRI1 (methylthioribose-1-phosphate isomerase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mri1 (methylthioribose-1-phosphate isomerase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG11334	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C01G10.9	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	MRI1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	MRI1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mri1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	40,812,114 - 40,819,846 (+)	NCBI		GRCr8
GRCr8 Ensembl	19	40,812,094 - 40,822,607 (+)	Ensembl		GRCr8 Ensembl
mRatBN7.2	19	23,907,327 - 23,913,721 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	23,907,335 - 23,913,320 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	30,728,393 - 30,734,786 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	31,382,802 - 31,389,195 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	33,605,548 - 33,611,943 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	25,360,299 - 25,366,283 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	25,360,164 - 25,366,806 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	36,336,487 - 36,342,471 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	25,591,115 - 25,597,099 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	19	23,456,210 - 23,462,198 (+)	NCBI		Celera
RGSC_v3.1	19	25,595,940 - 25,601,925 (+)	NCBI
Cytogenetic Map	19	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

neurodegenerative disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

antirheumatic drug (ISO)

bisphenol A (ISO)

bisphenol F (ISO)

cadmium dichloride (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

doxorubicin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

flutamide (EXP)

folic acid (ISO)

glyphosate (ISO)

isoniazide (ISO)

ivermectin (ISO)

nefazodone (EXP)

nickel sulfate (ISO)

ochratoxin A (EXP)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

quercetin (ISO)

rotenone (EXP)

sodium arsenite (ISO)

Soman (EXP)

sunitinib (ISO)

temozolomide (ISO)

testosterone (ISO)

tetrachloroethene (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

amino acid biosynthetic process (IEA)

L-methionine salvage from methylthioadenosine (IBA,IEA)

methionine biosynthetic process (IEA)

Cellular Component

cytoplasm (IEA)

cytosol (ISO)

fibrillar center (ISO)

nucleoplasm (ISO)

nucleus (IEA)

Molecular Function

identical protein binding (ISO)

isomerase activity (IEA)

protein binding (ISO)

S-methyl-5-thioribose-1-phosphate isomerase activity (IBA,IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

cysteine and methionine metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:16189514	PMID:19447967	PMID:25416956

Genomics

Comparative Map Data

Mri1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	40,812,114 - 40,819,846 (+)	NCBI		GRCr8
GRCr8 Ensembl	19	40,812,094 - 40,822,607 (+)	Ensembl		GRCr8 Ensembl
mRatBN7.2	19	23,907,327 - 23,913,721 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	23,907,335 - 23,913,320 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	30,728,393 - 30,734,786 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	31,382,802 - 31,389,195 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	33,605,548 - 33,611,943 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	25,360,299 - 25,366,283 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	25,360,164 - 25,366,806 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	36,336,487 - 36,342,471 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	25,591,115 - 25,597,099 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	19	23,456,210 - 23,462,198 (+)	NCBI		Celera
RGSC_v3.1	19	25,595,940 - 25,601,925 (+)	NCBI
Cytogenetic Map	19	q11	NCBI

MRI1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	13,764,522 - 13,774,282 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	13,764,522 - 13,774,282 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	13,875,336 - 13,885,096 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	13,736,337 - 13,746,096 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	19	13,769,122 - 13,778,884 (+)	NCBI		Celera
Cytogenetic Map	19	p13.13	NCBI
HuRef	19	13,447,016 - 13,456,733 (+)	NCBI		HuRef
CHM1_1	19	13,875,880 - 13,885,599 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	13,890,747 - 13,900,482 (+)	NCBI		T2T-CHM13v2.0

Mri1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	84,977,205 - 84,983,953 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	84,976,535 - 84,983,955 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	84,250,576 - 84,257,324 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	84,249,906 - 84,257,326 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	86,774,475 - 86,781,223 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	87,140,011 - 87,147,431 (-)	NCBI		MGSCv36	mm8
Celera	8	88,552,772 - 88,559,465 (-)	NCBI		Celera
Cytogenetic Map	8	C2	NCBI
cM Map	8	40.74	NCBI

Mri1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	32,585,756 - 32,589,261 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	32,585,714 - 32,589,343 (+)	NCBI	ChiLan1.0	ChiLan1.0

MRI1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	18,694,501 - 18,703,250 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	17,695,420 - 17,704,140 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	13,327,569 - 13,336,286 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	14,060,777 - 14,067,521 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	14,060,859 - 14,067,222 (+)	Ensembl	panpan1.1		panPan2

MRI1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	48,648,987 - 48,658,231 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	48,653,152 - 48,658,160 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	48,522,944 - 48,532,179 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	49,167,118 - 49,176,373 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	49,171,006 - 49,176,338 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	48,377,542 - 48,386,796 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	48,804,655 - 48,813,684 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	49,047,748 - 49,056,780 (-)	NCBI		UU_Cfam_GSD_1.0

Mri1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	207,822,219 - 207,827,836 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936659	2,527,472 - 2,532,416 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936659	2,526,274 - 2,532,878 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MRI1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	65,348,006 - 65,355,118 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	65,348,609 - 65,354,892 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	65,675,853 - 65,682,136 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MRI1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	12,424,835 - 12,431,911 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	12,425,052 - 12,431,844 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666074	7,254,693 - 7,263,317 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mri1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624901	1,106,059 - 1,109,931 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624901	1,105,763 - 1,110,281 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Mri1
44 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	32
Count of miRNA genes:	29
Interacting mature miRNAs:	31
Transcripts:	ENSRNOT00000003762
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	7997750	52997750	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	19220689	64220689	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	7997750	52997750	Rat
631840	Niddm38	Non-insulin dependent diabetes mellitus QTL 38	3.86		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	19	10329076	74246245	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	19	5748064	50748064	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	32365311	74246245	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	36289	74246245	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	24093973	69093973	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10833618	74246245	Rat
2303628	Vencon9	Ventilatory control QTL 9		0.005	respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	19	23188586	68188586	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	32539615	74246245	Rat
1558656	Prcs1	Prostate cancer susceptibility QTL 1	5		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	19	31287532	51431640	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	7997750	52997750	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	7997750	52997750	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	31777888	74246245	Rat
1554318	Bmd5	Bone mineral density QTL 5	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	19	23188586	68188586	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	20109306	65109306	Rat
1354607	Gmadr1	Adrenal mass QTL 1	5.83		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	19	40727092	54856850	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2194317	74246245	Rat
1354600	Salc2	Saline consumption QTL 2	9.91	0.001	drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	19	40727092	54856850	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2194317	74246245	Rat
1354633	Bw28	Body weight QTL 28	6.04		body mass (VT:0001259)	body weight (CMO:0000012)	19	40727092	54856850	Rat
61407	Scl12	Serum cholesterol level QTL 12		0.001	blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	19	30099383	47207961	Rat

Markers in Region

RH126162

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	19	36,343,813 - 36,344,047	NCBI	Rnor5.0
RGSC_v3.4	19	25,589,539 - 25,589,772	UniSTS	RGSC3.4
Celera	19	23,454,634 - 23,454,867	UniSTS
Cytogenetic Map	19	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
9	11	49	113	91	90	59	25	59	6	218	97	11	93	45	60	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001010947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277829	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC089060	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213644	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000003762 ⟹ ENSRNOP00000003762

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	40,812,118 - 40,818,522 (+)	Ensembl
mRatBN7.2 Ensembl	19	23,907,335 - 23,913,320 (+)	Ensembl
Rnor_6.0 Ensembl	19	25,360,164 - 25,366,806 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000139156 ⟹ ENSRNOP00000112586

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	40,812,094 - 40,822,607 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000165240 ⟹ ENSRNOP00000101093

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	40,812,094 - 40,822,607 (+)	Ensembl

RefSeq Acc Id:

NM_001010947 ⟹ NP_001010947

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	40,812,132 - 40,818,525 (+)	NCBI
mRatBN7.2	19	23,907,327 - 23,913,721 (+)	NCBI
Rnor_6.0	19	25,360,299 - 25,366,283 (-)	NCBI
Rnor_5.0	19	36,336,487 - 36,342,471 (-)	NCBI
RGSC_v3.4	19	25,591,115 - 25,597,099 (+)	RGD
Celera	19	23,456,210 - 23,462,198 (+)	RGD

Sequence:

show sequence

CGCAACCTGTGCGGGATTCTGTGTGGCCCTGTACGGTAGGCAACATGAGACTGGAAGCGATCCG
CTACTCGCCGGGCTCGCTGCAGATCCTCGACCAGCTGCAGCTGCCGGAGCACTGCCACTATGAG
ACGCTGAGCTCCGTGCAGCAGGCCAGGGAAGCGATCCGCGCCATGAAGGTGCGCGGCGCTCCCG
CCATCGCGCTGGTGGGTTGCCTCAGCCTGGCTGTAGAGCTGCAGGCGGGTGCGGGCGGTCCGGG
GCTCGCCGCTCTGGTGGCCTTCGTGCGAGACCAGCTGAGCCTCCTTGTCGCCGCCCGGCCCACA
GCTGTCAACATGGCCCGCGCCGCCCGCGATCTGACTCACATGGCGGCCCGAGAGGCGGAACTAG
AGGGTGCTACTGAAGAGACCGTGCGGGAAAGAGTGATCCGCTTTGCCGAGGACATGTTGGAGAA
AGACCTCAAAGATAACCGGAGCATTGGCGACTTGGGAGCCCGCCATCTCCTAGAGCAGACCAAC
CCCAGGGGTGGCAAGGTGACTGTGCTGACCCACTGTAACACCGGTGCTCTGGCCACTGCCGGCT
ACGGTACAGCATTAGGTGTGATCCGCTCACTGCACGAGATGGGTCGACTGGAGCATACCTTCTG
CACGGAAACCCGGCCCTACAACCAGGGAGCACGGCTGACAGCCTTCGAGCTGGTGTACGAGAAG
ATCCCTGCGACTCTCATCACTGACAGTATGGCCGCTGCAGCCATGGTACACCAGGGTGTGTCAG
CTGTGGTGGTGGGAGCTGATCGTGTTGTTGCCAACGGAGACACAGCCAACAAGATAGGCACCTA
CCAGCTGGCCATCGTCGCCAAGCACCACGGTATCCCCTTCTATGTGGCTGCCCCCAGTTCATCC
TGTGACCTCCGTCTGGAGACTGGAAAGGAGATTGTCATAGAGGAACGCCCCAGCCAGGAGCTGA
CTGACCTGAATGGAGTCAGGATTGCTGCACAGGGAATCCGGGTTTGGAATCCTGCCTTTGATGT
CACCCCCCACGAACTCATCACAGGCGGCATCATCACTGAGCTGGGTGTCTTTGCCCCTGAGGAG
CTCCGTGCAGCCCTAAGCGCCACCATCTTCTCAGAGGGACAGACCCTAGATAGTCCCCAGATGT
GACTAGCTGGCTTCCCCTGCCCTGCCTTCTTCTGGTTTTATAATAAAGTTCTCAAATGGCAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAGG

hide sequence

RefSeq Acc Id:

XM_063277829 ⟹ XP_063133899

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	40,812,114 - 40,819,846 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001010947	(Get FASTA)	NCBI Sequence Viewer
	XP_063133899	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH89060	(Get FASTA)	NCBI Sequence Viewer
	EDL92227	(Get FASTA)	NCBI Sequence Viewer
	EDL92228	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000003762
	ENSRNOP00000003762.4
GenBank Protein	Q5HZE4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001010947 ⟸ NM_001010947

- UniProtKB:

Q5HZE4 (UniProtKB/Swiss-Prot), A6IY99 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRLEAIRYSPGSLQILDQLQLPEHCHYETLSSVQQAREAIRAMKVRGAPAIALVGCLSLAVELQ
AGAGGPGLAALVAFVRDQLSLLVAARPTAVNMARAARDLTHMAAREAELEGATEETVRERVIRF
AEDMLEKDLKDNRSIGDLGARHLLEQTNPRGGKVTVLTHCNTGALATAGYGTALGVIRSLHEMG
RLEHTFCTETRPYNQGARLTAFELVYEKIPATLITDSMAAAAMVHQGVSAVVVGADRVVANGDT
ANKIGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGKEIVIEERPSQELTDLNGVRIAAQGIRV
WNPAFDVTPHELITGGIITELGVFAPEELRAALSATIFSEGQTLDSPQM

hide sequence

Ensembl Acc Id:

ENSRNOP00000003762 ⟸ ENSRNOT00000003762

RefSeq Acc Id:	XP_063133899 ⟸ XM_063277829
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000112586 ⟸ ENSRNOT00000139156

Ensembl Acc Id:

ENSRNOP00000101093 ⟸ ENSRNOT00000165240

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5HZE4-F1-model_v2	AlphaFold	Q5HZE4	1-369	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701017

Promoter ID:

EPDNEW_R11541

Type:

initiation region

Name:

Mri1_1

Description:

methylthioribose-1-phosphate isomerase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	25,366,271 - 25,366,331	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307789	AgrOrtholog
BioCyc Gene	G2FUF-6099	BioCyc
Ensembl Genes	ENSRNOG00000026211	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000003762	ENTREZGENE
	ENSRNOT00000003762.7	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.120.420	UniProtKB/Swiss-Prot
	Translation initiation factor eif-2b, domain 2	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7320396	IMAGE-MGC_LOAD
InterPro	IF-2B-related	UniProtKB/Swiss-Prot
	IF-M1Pi	UniProtKB/Swiss-Prot
	IF_2B-like_C	UniProtKB/Swiss-Prot
	Initiation_fac_2B_a/b/d	UniProtKB/Swiss-Prot
	M1Pi_N	UniProtKB/Swiss-Prot
	NagB/RpiA_transferase-like	UniProtKB/Swiss-Prot
KEGG Report	rno:288912	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105780	IMAGE-MGC_LOAD
NCBI Gene	288912	ENTREZGENE
PANTHER	METHYLTHIORIBOSE-1-PHOSPHATE ISOMERASE	UniProtKB/Swiss-Prot
	METHYLTHIORIBOSE-1-PHOSPHATE ISOMERASE	UniProtKB/Swiss-Prot
Pfam	IF-2B	UniProtKB/Swiss-Prot
PhenoGen	Mri1	PhenoGen
RatGTEx	ENSRNOG00000026211	RatGTEx
Superfamily-SCOP	SSF100950	UniProtKB/Swiss-Prot
UniProt	A6IY99	ENTREZGENE, UniProtKB/TrEMBL
	MTNA_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-06-05	Mri1	methylthioribose-1-phosphate isomerase 1	Mri1	methylthioribose-1-phosphate isomerase homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-06-12	Mri1	methylthioribose-1-phosphate isomerase homolog (S. cerevisiae)	RGD1307789	translation initiation factor eIF-2B subunit alpha/beta/delta-like protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-01-20	RGD1307789	translation initiation factor eIF-2B subunit alpha/beta/delta-like protein	RGD1307789	similar to hypothetical protein MGC3207	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1307789	similar to hypothetical protein MGC3207	RGD1307789_predicted	similar to hypothetical protein MGC3207 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1307789_predicted	similar to hypothetical protein MGC3207 (predicted)	LOC288912_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC288912_predicted	similar to hypothetical protein MGC3207 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)