Snx20 (sorting nexin 20) - Rat Genome Database

Name: Snx20
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Snx20 (sorting nexin 20) Rattus norvegicus

Analyze

Symbol:

Snx20

Name:

sorting nexin 20

RGD ID:

1307787

Description:

Predicted to enable phosphatidylinositol-3-phosphate binding activity and phosphatidylinositol-4,5-bisphosphate binding activity. Predicted to be involved in protein transport. Predicted to be located in nucleoplasm. Predicted to be active in early endosome membrane. Orthologous to human SNX20 (sorting nexin 20); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acetamide; aflatoxin B1.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC307742; MGC108869; RGD1307787; selectin ligand interactor cytoplasmic-1; similar to RIKEN cDNA 9130017C17 gene; Slic1; sorting nexin-20

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SNX20 (sorting nexin 20)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Snx20 (sorting nexin 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Snx20 (sorting nexin 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SNX20 (sorting nexin 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SNX20 (sorting nexin 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SNX20 (sorting nexin 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SNX20 (sorting nexin 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Snx20 (sorting nexin 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ZMYM2 (zinc finger MYM-type containing 2)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Snx20 (sorting nexin 20)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SNX20 (sorting nexin 20)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	snx20 (sorting nexin 20)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG3077	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	34,609,397 - 34,618,569 (+)	NCBI		GRCr8
mRatBN7.2	19	18,435,935 - 18,445,108 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	18,435,935 - 18,445,107 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	20,115,486 - 20,124,660 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	25,310,096 - 25,319,280 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	28,267,854 - 28,277,004 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	19,395,655 - 19,404,846 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	19,395,655 - 19,404,835 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	30,428,393 - 30,436,777 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	19,715,997 - 19,726,145 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	19,720,822 - 19,730,970 (+)	NCBI
Celera	19	18,322,643 - 18,331,589 (+)	NCBI		Celera
Cytogenetic Map	19	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Chromosome 16q12 Duplication Syndrome (ISO)

nephronophthisis 14 (ISO)

Townes-Brocks syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

7,12-dimethyltetraphene (ISO)

acetamide (EXP)

aflatoxin B1 (EXP)

Aflatoxin B2 alpha (ISO)

alpha-Zearalanol (EXP)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

buta-1,3-diene (ISO)

carbon nanotube (ISO)

Cuprizon (EXP)

Dibutyl phosphate (ISO)

dichloroacetic acid (ISO)

epoxiconazole (ISO)

folic acid (ISO)

furan (EXP)

lidocaine (EXP)

lipopolysaccharide (ISO)

manganese(II) chloride (EXP)

methyl methanesulfonate (ISO)

N-methyl-4-phenylpyridinium (EXP)

nickel atom (ISO)

ozone (ISO)

paracetamol (ISO)

sodium arsenite (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

protein transport (IEA)

Cellular Component

early endosome membrane (IBA,ISO,ISS)

nucleoplasm (IEA,ISO)

plasma membrane (IEA)

Molecular Function

phosphatidylinositol phosphate binding (IBA)

phosphatidylinositol-3-phosphate binding (ISO,ISS)

phosphatidylinositol-4,5-bisphosphate binding (ISO,ISS)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:25882846

Genomics

Comparative Map Data

Snx20
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	34,609,397 - 34,618,569 (+)	NCBI		GRCr8
mRatBN7.2	19	18,435,935 - 18,445,108 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	18,435,935 - 18,445,107 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	20,115,486 - 20,124,660 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	25,310,096 - 25,319,280 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	28,267,854 - 28,277,004 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	19,395,655 - 19,404,846 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	19,395,655 - 19,404,835 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	30,428,393 - 30,436,777 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	19,715,997 - 19,726,145 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	19,720,822 - 19,730,970 (+)	NCBI
Celera	19	18,322,643 - 18,331,589 (+)	NCBI		Celera
Cytogenetic Map	19	p11	NCBI

SNX20
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	50,666,300 - 50,681,312 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	50,666,300 - 50,681,353 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	50,700,211 - 50,715,223 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	49,264,387 - 49,272,667 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	16	35,215,527 - 35,230,577 (-)	NCBI		Celera
Cytogenetic Map	16	q12.1	NCBI
HuRef	16	36,588,004 - 36,603,054 (-)	NCBI		HuRef
CHM1_1	16	52,107,729 - 52,122,779 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	56,463,916 - 56,478,923 (-)	NCBI		T2T-CHM13v2.0

Snx20
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	89,353,189 - 89,362,769 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	89,353,191 - 89,362,756 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	88,626,561 - 88,636,133 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	88,626,563 - 88,636,128 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	91,150,727 - 91,160,027 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	91,516,933 - 91,526,233 (-)	NCBI		MGSCv36	mm8
Celera	8	92,907,268 - 92,916,455 (-)	NCBI		Celera
Cytogenetic Map	8	C3	NCBI
cM Map	8	43.51	NCBI

Snx20
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955433	8,727,493 - 8,731,398 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955433	8,725,950 - 8,734,699 (-)	NCBI	ChiLan1.0	ChiLan1.0

SNX20
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	60,124,381 - 60,138,701 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	66,030,121 - 66,044,337 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	30,928,545 - 30,944,509 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	49,814,315 - 49,822,209 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	49,809,077 - 49,818,459 (-)	Ensembl	panpan1.1		panPan2

SNX20
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	64,681,329 - 64,689,825 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	64,681,303 - 64,692,486 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	61,254,013 - 61,262,796 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	65,226,579 - 65,235,362 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	65,226,554 - 65,237,740 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	62,050,248 - 62,059,016 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	63,070,208 - 63,078,984 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	63,957,752 - 63,966,522 (+)	NCBI		UU_Cfam_GSD_1.0

SNX20
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	34,176,748 - 34,191,570 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	34,176,753 - 34,188,233 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

SNX20
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	36,467,839 - 36,481,083 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	36,469,366 - 36,480,514 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	40,021,561 - 40,031,658 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Snx20
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624757	6,014,238 - 6,019,378 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624757	6,011,750 - 6,019,378 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Snx20
122 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	41
Count of miRNA genes:	39
Interacting mature miRNAs:	41
Transcripts:	ENSRNOT00000019130
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549847	Bss8	Bone structure and strength QTL 8	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	19	1	31963836	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
631681	Cm12	Cardiac mass QTL 12	3.33	0.00053	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	19	1	28982497	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	1	36824771	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
1558656	Prcs1	Prostate cancer susceptibility QTL 1	5		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	19	15114598	34521833	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	1	36824771	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	15605023	46559041	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
724565	Tcas5	Tongue tumor susceptibility QTL 5	10.04		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	19	9977753	39654489	Rat
61407	Scl12	Serum cholesterol level QTL 12		0.001	blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	19	13926401	30303727	Rat
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	1	36824771	Rat
631840	Niddm38	Non-insulin dependent diabetes mellitus QTL 38	3.86		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	19	10323180	23069265	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
10054132	Srcrt9	Stress Responsive Cort QTL 9	2.87	0.0017	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	27355345	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	7457249	42983518	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10827970	43544039	Rat
7411590	Foco7	Food consumption QTL 7	6.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	19	1	24688055	Rat
631678	Cm9	Cardiac mass QTL 9	4.27	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	19	1	28982497	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	36824771	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001024999	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772402	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC091194	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474037	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019130 ⟹ ENSRNOP00000019130

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	18,435,935 - 18,445,107 (+)	Ensembl
Rnor_6.0 Ensembl	19	19,395,655 - 19,404,835 (+)	Ensembl

RefSeq Acc Id:

NM_001024999 ⟹ NP_001020170

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	34,609,397 - 34,618,569 (+)	NCBI
mRatBN7.2	19	18,435,935 - 18,445,108 (+)	NCBI
Rnor_6.0	19	19,395,655 - 19,404,836 (+)	NCBI
Rnor_5.0	19	30,428,393 - 30,436,777 (+)	NCBI
RGSC_v3.4	19	19,715,997 - 19,726,145 (+)	RGD
Celera	19	18,322,643 - 18,331,589 (+)	RGD

Sequence:

show sequence

GACGTTCGACCGTCCAGTTGGACCTTGCAAAAAGAGATCGAAATGGAGCATGTGACCCTCCTGG
ACCTCTGAACCCACAAAGCCTGAAGATTCCAGGCACCCTTGGAGCATGGCAAGTCCACAGCATC
CTGGGGGCCCTGGCTGGACAGGACCCAGAAACCAATGCATAACAAGGACCAGACAGGAAGTCCT
GCCCCCAGGTCCAGACCTCCCATGTCCAGGCCCAGAAGAAGCCCAAGATGGTCCCACCTCCAAC
TCCAACATGACCACAAGGGAGCTACAGGAACACTGGCAGAAGGAAAAGAGCCGCTGGAAACACG
TCAGGCTCCTCTTTGAGATCGCCTCAGCCAGAATCGAGGAGAGGAAAGTCTCCAAGTTTGTGAT
GTACCAGGTCGTGGTCATCCAGACTGGGAGCTTCGACAGCGACAAGGCTGTGGTGGAGCGGCGC
TACTCGGACTTCGAGAGGCTGCAGAGGGCCCTCCTGAAGCGCTTCGGGCCGGAGCTGGAGGACG
TGACGTTCCCGCGGAAGCGCCTGACCGGGAACCTGTCGGCCGAGACCATCTGCGAACGGCGCCT
GGAGCTGCGCGAGTACCTGCGGCTGCTGTACGCCGTGCGCGCCGTGCGCCGCTCGCGCGAGTTC
GCCGACTTCCTTACGCGGCCCGAGCTGTGCGAGGCCTTCGGCTGCCTGCGCGCCGGCCAGTACG
CGCGCGCGCTCGACCTGCTGGGCCGCGTGGTGCCGCTGCAGGAGAAGCTCACGGCGCACTGCCC
GAGCGCTCCCGTGCCTGCTCTCTGCGCCATGCTCGTGTGCCTGCGCGACCTGGAGCGGCCGGCC
GAGGCCTTCGCGGTCGGCGAGCGCGCGCTGCGACGCCTGGGGGCGCGCGAGAGCCACCGCTACT
ACGCGCCGCTGCTGGACGCCATGGTGCGCCTGGCCTACGCGCTGGGCAAGGACTTGGCGTCGCT
GCAGGGCCGGCTGGATGAGAGCCAGCTCCGGAGGCCCACACACAGGGGCGCCACCCTGAAGGAG
CTCACCGTGCGGGAGTATCTGTCCTGAGGCGGCCCGACAGGTGCCCTGGCATCCATGCTACGTG
GACAGAGACATGGGTCGCCATTGCTAGTGGGCTTTACTGGGCAGCTTTGTACAAGCCCGTGTCT
GCTGAGCAGAGGGTTTCCTGCGACCCCTGGAAGAGCCATCTTGTGCCTCTTGAGTGCCGGGTTC
TCCAAATCCTAAGCCCACAAGGTTAGCTGTCAGAACTTTTCAATTACTATGGACTTGCATGGGA
AGGACTTGCCTACCGCACAGAATCAGTTCAAGGCCAGCCTAGGCAGTTTGCTGAGAATGGCTCC
AAAATAAAGAGGTCTGAGGATGTGAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001020170	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91194	(Get FASTA)	NCBI Sequence Viewer
	EDL87528	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019130.4
	ENSRNOP00055027021
	ENSRNOP00060021622
GenBank Protein	Q5BK61	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001020170 ⟸ NM_001024999

- UniProtKB:

Q5BK61 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MASPQHPGGPGWTGPRNQCITRTRQEVLPPGPDLPCPGPEEAQDGPTSNSNMTTRELQEHWQKE
KSRWKHVRLLFEIASARIEERKVSKFVMYQVVVIQTGSFDSDKAVVERRYSDFERLQRALLKRF
GPELEDVTFPRKRLTGNLSAETICERRLELREYLRLLYAVRAVRRSREFADFLTRPELCEAFGC
LRAGQYARALDLLGRVVPLQEKLTAHCPSAPVPALCAMLVCLRDLERPAEAFAVGERALRRLGA
RESHRYYAPLLDAMVRLAYALGKDLASLQGRLDESQLRRPTHRGATLKELTVREYLS

hide sequence

Ensembl Acc Id:

ENSRNOP00000019130 ⟸ ENSRNOT00000019130

Protein Domains

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5BK61-F1-model_v2	AlphaFold	Q5BK61	1-313	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700975

Promoter ID:

EPDNEW_R11499

Type:

multiple initiation site

Name:

Snx20_1

Description:

sorting nexin 20

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	19,395,643 - 19,395,703	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307787	AgrOrtholog
BioCyc Gene	G2FUF-6279	BioCyc
Ensembl Genes	ENSRNOG00000014202	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055019519	UniProtKB/Swiss-Prot
	ENSRNOG00060015755	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000019130.6	UniProtKB/Swiss-Prot
	ENSRNOT00055033310	UniProtKB/Swiss-Prot
	ENSRNOT00060026965	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.1520.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7373920	IMAGE-MGC_LOAD
InterPro	Phox	UniProtKB/Swiss-Prot
	PX_dom_sf	UniProtKB/Swiss-Prot
	SNX20/SNX21	UniProtKB/Swiss-Prot
KEGG Report	rno:307742	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108869	IMAGE-MGC_LOAD
NCBI Gene	307742	ENTREZGENE
PANTHER	PTHR20939	UniProtKB/Swiss-Prot
	SORTING NEXIN-20	UniProtKB/Swiss-Prot
Pfam	PF00787	UniProtKB/Swiss-Prot
PhenoGen	Snx20	PhenoGen
PROSITE	PS50195	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000014202	RatGTEx
	ENSRNOG00055019519	RatGTEx
	ENSRNOG00060015755	RatGTEx
SMART	SM00312	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF64268	UniProtKB/Swiss-Prot
UniProt	Q5BK61	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-24	Snx20	sorting nexin 20	Slic1	selectin ligand interactor cytoplasmic-1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Slic1	selectin ligand interactor cytoplasmic-1	RGD1307787	similar to RIKEN cDNA 9130017C17 gene	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1307787	similar to RIKEN cDNA 9130017C17 gene	RGD1307787_predicted	similar to RIKEN cDNA 9130017C17 gene (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1307787_predicted	similar to RIKEN cDNA 9130017C17 gene (predicted)	LOC307742_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC307742_predicted	similar to RIKEN cDNA 9130017C17 gene (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar