Advanced Search (OLGA)

Gene: Adsl (adenylosuccinate lyase) Rattus norvegicus

Analyze

Symbol:

Adsl

Name:

adenylosuccinate lyase

RGD ID:

1307617

Description:

Enables (S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamido) succinate lyase (fumarate-forming) activity; N6-(1,2-dicarboxyethyl)AMP AMP-lyase (fumarate-forming) activity; and identical protein binding activity. Involved in several processes, including AMP biosynthetic process; response to hypoxia; and response to muscle activity. Predicted to be part of protein-containing complex. Predicted to be active in cytosol. Biomarker of breast cancer. Human ortholog(s) of this gene implicated in adenylosuccinase lyase deficiency. Orthologous to human ADSL (adenylosuccinate lyase); PARTICIPATES IN adenine phoshoribosyltransferase deficiency pathway; adenosine monophosphate deaminase deficiency pathway; adenylosuccinate lyase deficiency pathway; INTERACTS WITH 2,4-dinitrotoluene; 2,6-dinitrotoluene; 4-amino-2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC315150

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ADSL (adenylosuccinate lyase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Adsl (adenylosuccinate lyase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Adsl (adenylosuccinate lyase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ADSL (adenylosuccinate lyase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ADSL (adenylosuccinate lyase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Adsl (adenylosuccinate lyase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ADSL (adenylosuccinate lyase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ADSL (adenylosuccinate lyase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Adsl (adenylosuccinate lyase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GNG8 (G protein subunit gamma 8)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	ADSL (adenylosuccinate lyase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Adsl (adenylosuccinate lyase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	adsl (adenylosuccinate lyase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ADE13	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	AdSL	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	adsl-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	adsl	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	114,359,440 - 114,383,618 (+)	NCBI		GRCr8
mRatBN7.2	7	112,479,256 - 112,503,439 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	112,479,271 - 112,503,760 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	114,234,797 - 114,258,837 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	116,458,339 - 116,482,381 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	116,427,712 - 116,451,754 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	122,157,201 - 122,192,328 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	122,157,201 - 122,192,328 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	122,148,984 - 122,176,665 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	119,223,582 - 119,248,151 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	119,257,809 - 119,282,215 (+)	NCBI
Celera	7	108,802,820 - 108,827,084 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenylosuccinase lyase deficiency (ISO)

autism spectrum disorder (ISO)

autistic disorder (ISO)

breast cancer (IEP,ISO)

Experimental Diabetes Mellitus (IEP)

Experimental Liver Neoplasms (IEP)

genetic disease (ISO)

intellectual disability (ISO)

Myoclonic Epilepsies (ISO)

prostate cancer (ISO)

Rubinstein-Taybi syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-amino-14,16-dimethyloctadecan-3-ol (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-amino-2,6-dinitrotoluene (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

arsenous acid (ISO)

benzatropine (ISO)

benzene-1,2,4-triol (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

chromium(6+) (ISO)

clofibric acid (EXP)

copper(II) sulfate (ISO)

Cuprizon (ISO)

diarsenic trioxide (ISO)

diazinon (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

genistein (ISO)

gentamycin (EXP)

haloperidol (ISO)

hydralazine (ISO)

ivermectin (ISO)

lead(0) (ISO)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

nimesulide (EXP)

oxaliplatin (EXP)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

pirinixic acid (ISO)

resveratrol (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sunitinib (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

trimellitic anhydride (ISO)

valproic acid (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

'de novo' AMP biosynthetic process (IBA,IEA,ISO)

'de novo' IMP biosynthetic process (IEA,ISO)

'de novo' XMP biosynthetic process (IEA,ISO)

aerobic respiration (IMP)

AMP biosynthetic process (IDA,IEA,ISO)

AMP salvage (IEA,ISO)

GMP biosynthetic process (IEA,ISO)

purine nucleotide biosynthetic process (IEA)

purine ribonucleoside monophosphate biosynthetic process (IEA)

purine ribonucleotide biosynthetic process (IEA)

response to hypoxia (IEP)

response to muscle activity (IEP)

response to nutrient (IDA)

response to starvation (IEP)

Cellular Component

cytosol (IBA,IEA,ISO)

protein-containing complex (IEA,ISO)

Molecular Function

(S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamido) succinate lyase (fumarate-forming) activity (IBA,IDA,IEA,ISO)

catalytic activity (IEA)

identical protein binding (IEA,IPI,ISO)

lyase activity (IEA)

N6-(1,2-dicarboxyethyl)AMP AMP-lyase (fumarate-forming) activity (IBA,IDA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

adenine phoshoribosyltransferase deficiency pathway (ISO)

adenosine monophosphate deaminase deficiency pathway (ISO)

adenylosuccinate lyase deficiency pathway (ISO)

AICA-ribosuria pathway (ISO)

alanine, aspartate and glutamate metabolic pathway (IEA)

azathioprine pharmacodynamics pathway (ISO)

Canavan disease pathway (ISO)

de novo purine biosynthetic pathway (ISO)

Kelley-Seegmiller syndrome pathway (ISO)

Lesch-Nyhan syndrome pathway (ISO)

mercaptopurine pharmacodynamics pathway (ISO)

molybdenum cofactor deficiency pathway (ISO)

purine metabolic pathway (IEA,ISO)

purine nucleoside phosphorylase deficiency pathway (ISO)

tioguanine pharmacodynamics pathway (ISO)

xanthinuria type I pathway (ISO)

xanthinuria pathway (ISO)

xanthinuria type II pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Effect of diet on adenylosuccinase activity in various organs of rat and chicken.	Brand LM and Lowenstein JM, J Biol Chem. 1978 Oct 10;253(19):6872-8.
2.	Pediatric neurological syndromes and inborn errors of purine metabolism.	Camici M, etal., Neurochem Int. 2010 Feb;56(3):367-78. Epub 2009 Dec 11.
3.	Purification of adenylosuccinate lyase from rat skeletal muscle by a novel affinity column. Stabilization of the enzyme, and effects of anions and fluoro analogues of the substrate.	Casey PJ and Lowenstein JM, Biochem J. 1987 Sep 1;246(2):263-9.
4.	Metabolism of threo-beta-fluoroaspartate by H4 cells. Inhibition of adenylosuccinate lyase by fluoro analogs of its substrates.	Casey PJ, etal., J Biol Chem. 1986 Oct 15;261(29):13637-42.
5.	Importance of purine nucleotide cycle to energy production in skeletal muscle.	Flanagan WF, etal., Am J Physiol. 1986 Nov;251(5 Pt 1):C795-802.
6.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
8.	Adenine nucleotide metabolism in hearts of diabetic rats. Comparison to diaphragm, liver, and kidney.	Jenkins RL, etal., Diabetes. 1988 May;37(5):629-36.
9.	A comparison of succinyladenylate lyase activity and serum sialic acid as markers of malignancy.	Mack DO, etal., Biochem Med. 1985 Dec;34(3):327-34.
10.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
11.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
12.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
13.	Adenylosuccinate lyase as an indicator of breast and prostate malignancies: a preliminary report.	Reed VL, etal., Clin Biochem. 1987 Oct;20(5):349-51.
14.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
16.	A comparison of hepatic adenylosuccinate lyase from rats fed either a chow diet or a semisynthetic basal diet low in riboflavin.	Smith LD, etal., Int J Biochem. 1982;14(10):875-8.
17.	Purine nucleotide cycle in rat renal cortex and medulla under conditions that mimic normal and low oxygen supply.	Stepinski J, etal., Kidney Int. 1996 Oct;50(4):1195-201.

Additional References at PubMed

PMID:10888601	PMID:11428554	PMID:16973378	PMID:18614015

Genomics

Comparative Map Data

Adsl
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	114,359,440 - 114,383,618 (+)	NCBI		GRCr8
mRatBN7.2	7	112,479,256 - 112,503,439 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	112,479,271 - 112,503,760 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	114,234,797 - 114,258,837 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	116,458,339 - 116,482,381 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	116,427,712 - 116,451,754 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	122,157,201 - 122,192,328 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	122,157,201 - 122,192,328 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	122,148,984 - 122,176,665 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	119,223,582 - 119,248,151 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	119,257,809 - 119,282,215 (+)	NCBI
Celera	7	108,802,820 - 108,827,084 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

ADSL
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	40,346,500 - 40,387,527 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	40,346,461 - 40,390,463 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	40,742,504 - 40,783,531 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	39,072,509 - 39,092,698 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	22	39,067,062 - 39,087,251	NCBI
Celera	22	24,544,565 - 24,564,639 (+)	NCBI		Celera
Cytogenetic Map	22	q13.1	NCBI
HuRef	22	23,705,707 - 23,725,685 (+)	NCBI		HuRef
CHM1_1	22	40,701,395 - 40,721,469 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	40,817,910 - 40,858,924 (+)	NCBI		T2T-CHM13v2.0

Adsl
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	80,832,691 - 80,855,148 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	80,832,691 - 80,855,147 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	80,948,490 - 80,970,947 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	80,948,490 - 80,970,946 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	80,778,949 - 80,799,803 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	80,775,774 - 80,796,628 (+)	NCBI		MGSCv36	mm8
Celera	15	83,069,002 - 83,089,662 (+)	NCBI		Celera
Cytogenetic Map	15	E1	NCBI
cM Map	15	37.95	NCBI

Adsl
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	26,067,516 - 26,088,527 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955413	26,067,463 - 26,084,669 (+)	NCBI	ChiLan1.0	ChiLan1.0

ADSL
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	50,190,503 - 50,215,545 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	52,886,106 - 52,910,029 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	21,249,920 - 21,271,749 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	39,068,864 - 39,090,418 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	39,068,764 - 39,389,221 (+)	Ensembl	panpan1.1		panPan2

ADSL
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	24,813,854 - 24,832,115 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	24,748,849 - 24,767,156 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	25,564,321 - 25,582,627 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	25,564,251 - 25,582,606 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	25,276,233 - 25,290,696 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	25,598,775 - 25,617,073 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	25,773,156 - 25,791,459 (-)	NCBI		UU_Cfam_GSD_1.0

Adsl
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	8,413,366 - 8,430,396 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936492	1,423,780 - 1,440,825 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ADSL
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	8,025,508 - 8,047,603 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	8,027,799 - 8,045,480 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	5,260,243 - 5,278,007 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ADSL
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	22,920,971 - 22,940,468 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666045	102,650,098 - 102,671,844 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Adsl
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624752	8,098,088 - 8,118,091 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624752	8,098,612 - 8,117,635 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Adsl
112 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	58
Count of miRNA genes:	49
Interacting mature miRNAs:	54
Transcripts:	ENSRNOT00000025193
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
1300112	Bp183	Blood pressure QTL 183	3.51		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	111182207	135012528	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	102297359	133492884	Rat
2298475	Eau6	Experimental allergic uveoretinitis QTL 6		0.0029	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	7	84257275	129257275	Rat
71114	Niddm14	Non-insulin dependent diabetes mellitus QTL 14	4.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	84257275	129257275	Rat
1357336	Gluco6	Glucose level QTL 6	3.4		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	7	94811326	116294265	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	69736356	112729554	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	91412594	129807172	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	103146217	116738842	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	90482196	135012528	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	96670164	135012528	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2306821	Bp335	Blood pressure QTL 335		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	106571501	135012528	Rat
631663	Bw6	Body weight QTL 6	3.4		body mass (VT:0001259)	body weight (CMO:0000012)	7	111075573	134976056	Rat
1558655	Swd4	Spike wave discharge measurement QTL 4	3.68	0.0002	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge severity grade (CMO:0001988)	7	86983365	131983365	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
2313102	Bmd79	Bone mineral density QTL 79	2.3	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	7	94811085	116738842	Rat
731174	Uae23	Urinary albumin excretion QTL 23	2.4	0.0042	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	7	104603555	135012528	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	68938720	113886318	Rat
1331748	Bp215	Blood pressure QTL 215	4.043		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	112308254	133492884	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	68938720	113886318	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	91281130	135012528	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	68938720	113886318	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	69736226	117455174	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat

Markers in Region

AI172062

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	112,503,103 - 112,503,265 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	122,191,993 - 122,192,154	NCBI	Rnor6.0
Rnor_5.0	7	122,176,330 - 122,176,491	UniSTS	Rnor5.0
RGSC_v3.4	7	119,247,816 - 119,247,977	UniSTS	RGSC3.4
Celera	7	108,826,749 - 108,826,910	UniSTS
RH 3.4 Map	7	877.7	UniSTS
Cytogenetic Map	7	q34	UniSTS

RH130035

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	35,999,363 - 35,999,551 (+)	MAPPER	mRatBN7.2
mRatBN7.2	7	112,484,367 - 112,484,555 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	122,164,300 - 122,164,487	NCBI	Rnor6.0
Rnor_5.0	7	122,156,108 - 122,156,295	UniSTS	Rnor5.0
RGSC_v3.4	7	119,228,689 - 119,228,876	UniSTS	RGSC3.4
RGSC_v3.4	2	35,849,204 - 35,849,391	UniSTS	RGSC3.4
Celera	7	108,807,930 - 108,808,117	UniSTS
Celera	2	31,955,437 - 31,955,624	UniSTS
RH 3.4 Map	7	874.7	UniSTS
Cytogenetic Map	2	q13	UniSTS
Cytogenetic Map	7	q34	UniSTS

BI296865

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	36,001,246 - 36,001,444 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	122,166,183 - 122,166,380	NCBI	Rnor6.0
Rnor_5.0	7	122,157,991 - 122,158,188	UniSTS	Rnor5.0
RGSC_v3.4	2	35,851,087 - 35,851,284	UniSTS	RGSC3.4
Celera	2	31,957,320 - 31,957,517	UniSTS
RH 3.4 Map	2	148.7	UniSTS
Cytogenetic Map	7	q34	UniSTS

RH137134

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	112,503,169 - 112,503,372 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	122,192,059 - 122,192,261	NCBI	Rnor6.0
Rnor_5.0	7	122,176,396 - 122,176,598	UniSTS	Rnor5.0
RGSC_v3.4	7	119,247,882 - 119,248,084	UniSTS	RGSC3.4
Celera	7	108,826,815 - 108,827,017	UniSTS
Cytogenetic Map	7	q34	UniSTS

RH140918

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	112,503,170 - 112,503,371 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	122,192,060 - 122,192,260	NCBI	Rnor6.0
Rnor_5.0	7	122,176,397 - 122,176,597	UniSTS	Rnor5.0
RGSC_v3.4	7	119,247,883 - 119,248,083	UniSTS	RGSC3.4
Celera	7	108,826,816 - 108,827,016	UniSTS
RH 3.4 Map	7	877.7	UniSTS
Cytogenetic Map	7	q34	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001130503	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063263618	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025193 ⟹ ENSRNOP00000025193

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	112,479,280 - 112,503,380 (+)	Ensembl
Rnor_6.0 Ensembl	7	122,157,201 - 122,192,328 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094841 ⟹ ENSRNOP00000091765

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	112,479,297 - 112,503,760 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000110086 ⟹ ENSRNOP00000081561

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	112,479,297 - 112,503,760 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113152 ⟹ ENSRNOP00000094784

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	112,479,297 - 112,503,349 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000120130 ⟹ ENSRNOP00000077723

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	112,479,271 - 112,503,378 (+)	Ensembl

RefSeq Acc Id:

NM_001130503 ⟹ NP_001123975

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	114,359,440 - 114,383,618 (+)	NCBI
mRatBN7.2	7	112,479,259 - 112,503,439 (+)	NCBI
Rnor_6.0	7	122,157,201 - 122,192,328 (+)	NCBI
Rnor_5.0	7	122,148,984 - 122,176,665 (+)	NCBI
RGSC_v3.4	7	119,223,582 - 119,248,151 (+)	RGD
Celera	7	108,802,820 - 108,827,084 (+)	RGD

Sequence:

show sequence

CCCGCTACTGAAGTCCGCCGTAGCTGAGTCGCGTGTTGAAAATGGCTGCATCCGGGGACCCTGC
CTGTGCTGAAAGCTACCGTTCTCCGCTGGCGGCTCGCTACGCCAGCCATGAAATGTGCTTCTTG
TTCAGCGACAGGTACAAGTTCCAGACGTGGCGGCAGCTGTGGCTGTGGCTGGCGGAGGCCGAAC
AGACACTGGGTTTGCCTATCACGGATGAACAGATCCAGGAGATGAGGTCGAACCTGAGCAACAT
TGACTTCCAGATGGCAGCTGAGGAAGAGAAGCGCCTGCGGCACGACGTGATGGCTCATGTGCAC
ACGTTTGGCCACTGCTGTCCGAAAGCTGCTGGCATCATCCATCTTGGAGCCACCTCCTGCTATG
TTGGAGACAATACGGACTTGATTATTCTGAGAAATGCATTTGACCTGCTTTTACCAAAGCTTGC
TAGAGTGATCTCGAGGCTTGCCGACTTTGCTAAGGAACGTGCTGATCTGCCCACATTAGGTTTC
ACACACTTTCAGCCTGCTCAGCTGACCACGGTTGGGAAACGCTGCTGCCTTTGGATTCAAGATC
TCTGCATGGATCTTCAGAACTTGAAGCGTGTCCGAGATGAGCTGCGCTTCCGAGGAGTGAAGGG
CACCACTGGCACGCAGGCCAGCTTCTTGCAGCTCTTCGAGGGGGATCACCAGAAGGTGGAGCAG
CTGGACAAGATGGTGACAGAAAAGGCAGGGTTTAAAAGAGCTTACATCATCACAGGACAGACCT
ACACACGGAAAGTGGACATCGAAGTGCTGTCTGTGCTGGCCAGCCTAGGGGCGTCAGTGCACAA
GATTTGCACTGACATTCGCCTACTGGCGAACCTGAAGGAGATGGAGGAACCCTTTGAGAAGCAG
CAGATTGGTTCCAGTGCGATGCCGTACAAGCGGAACCCCATGCGCTCCGAACGTTGCTGCAGCT
TGGCTCGTCACCTGATGTCCCTTACCATGGACCCACTACAGACAGCTTCTGTGCAGTGGTTTGA
ACGTACCCTGGATGATAGTGCCAACCGACGGATCTGTTTGGCTGAAGCATTTCTCACTGCAGAC
ACTATATTAACTACTCTACAGAACGTCTCTGAAGGATTGGTGCTGTACCCCAAGGTAATTGAAC
GGCGCATTCGGCAAGAGCTTCCTTTCATGGCCACAGAGAACATTATCATGGCAATGGTCAAAGC
CGGGGGCAGCCGACAGGACTGTCATGAGAAAATTAGAGTGCTTTCCCAGCAGGCAGCTGCTGTG
GTTAAGCAGGAAGGGGGTGACAATGACCTTATAGAGCGCATTCGGGCAGATGCCTACTTCAGCC
CCATTCACTCACAGTTGGAACAATTGTTGGACCCCTCTTCTTTCACTGGCCGAGCTCCCCAGCA
GGTCCACAGATTCCTAGAAGAGGAGGTGTACCCCCTGCTGAAGCCCTACGGAAGTGTGATGGCA
GTGAAGGCGGAGCTGTGTCTGTAGAGGAGAGAATTATGGAAGAAACCTGATGAGTCTGCTAACT
ACAGTGTTAAGGAACTAGTGCTGTGTTCTGCAGGGCTCCTTTACCTGGGTGTGGTACATACTCA
GGAGGCAGGGACAAAGGCAGGCAGATCTCTGAGTTCAAGGCCAGCCTGGTCTACAGAGCAAGTT
CCAGGACAGCCAGGGCTACACAGAGAAACCACATCTCCAAAAAGCAAACAAACAAAAAGAATGT
ATATTAAGAATGTATACAGGACTCACAGCAGACAGCCATGCATTCTTGTTTTCTCCAGTCTGTT
GTTGCTGAGACAAAAATCTCACTGTATATCACGGACAGACCTGGAACACAGAAATCTGCCTCAT
CTCCCCAATGGCAGGATTAAAGGTGTTCCCCACCATGCCTGGCTGTTTTCTTTTTTTACAGCAA
CGTAATCTTAGAGAATAATGTAGCTCACACTT

hide sequence

RefSeq Acc Id:

XM_063263618 ⟹ XP_063119688

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	114,367,746 - 114,383,557 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001123975	(Get FASTA)	NCBI Sequence Viewer
	XP_063119688	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM15741	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025193.6
	ENSRNOP00000077723.1
	ENSRNOP00000081561
	ENSRNOP00000081561.1
	ENSRNOP00000091765.1
	ENSRNOP00000094784.1

RefSeq Acc Id:

NP_001123975 ⟸ NM_001130503

- UniProtKB:

A0A8I5ZTN5 (UniProtKB/TrEMBL), A6HSY1 (UniProtKB/TrEMBL), A0A8I6GJ79 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAASGDPACAESYRSPLAARYASHEMCFLFSDRYKFQTWRQLWLWLAEAEQTLGLPITDEQIQE
MRSNLSNIDFQMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNAF
DLLLPKLARVISRLADFAKERADLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDE
LRFRGVKGTTGTQASFLQLFEGDHQKVEQLDKMVTEKAGFKRAYIITGQTYTRKVDIEVLSVLA
SLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMSLTMDPLQ
TASVQWFERTLDDSANRRICLAEAFLTADTILTTLQNVSEGLVLYPKVIERRIRQELPFMATEN
IIMAMVKAGGSRQDCHEKIRVLSQQAAAVVKQEGGDNDLIERIRADAYFSPIHSQLEQLLDPSS
FTGRAPQQVHRFLEEEVYPLLKPYGSVMAVKAELCL

hide sequence

Ensembl Acc Id:

ENSRNOP00000025193 ⟸ ENSRNOT00000025193

Ensembl Acc Id:

ENSRNOP00000091765 ⟸ ENSRNOT00000094841

Ensembl Acc Id:

ENSRNOP00000077723 ⟸ ENSRNOT00000120130

Ensembl Acc Id:

ENSRNOP00000094784 ⟸ ENSRNOT00000113152

Ensembl Acc Id:

ENSRNOP00000081561 ⟸ ENSRNOT00000110086

RefSeq Acc Id:	XP_063119688 ⟸ XM_063263618
- Peptide Label:	isoform X1

Protein Domains

Adenylosuccinate lyase C-terminal Fumarate lyase N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZW08-F1-model_v2	AlphaFold	D3ZW08	1-484	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695501

Promoter ID:

EPDNEW_R6026

Type:

initiation region

Name:

Adsl_1

Description:

adenylosuccinate lyase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	122,157,217 - 122,157,277	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307617	AgrOrtholog
BioCyc Gene	G2FUF-32690	BioCyc
BioCyc Pathway	PWY-7219 [adenosine ribonucleotides de novo biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-7219	BioCyc
Ensembl Genes	ENSRNOG00000018655	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000025193.6	UniProtKB/TrEMBL
	ENSRNOT00000094841.1	UniProtKB/TrEMBL
	ENSRNOT00000110086	ENTREZGENE
	ENSRNOT00000110086.1	UniProtKB/TrEMBL
	ENSRNOT00000113152.1	UniProtKB/TrEMBL
	ENSRNOT00000120130.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.275.10	UniProtKB/TrEMBL
	1.10.275.60	UniProtKB/TrEMBL
	6.10.250.1570	UniProtKB/TrEMBL
	Fumarase/aspartase (C-terminal domain)	UniProtKB/TrEMBL
	Fumarase/aspartase (Central domain)	UniProtKB/TrEMBL
InterPro	AdenyloSucc_lyase_C_met/fun	UniProtKB/TrEMBL
	Fumarase/histidase_N	UniProtKB/TrEMBL
	Fumarate_lyase	UniProtKB/TrEMBL
	Fumarate_lyase_CS	UniProtKB/TrEMBL
	L-Aspartase-like	UniProtKB/TrEMBL
	Lyase1_N	UniProtKB/TrEMBL
	Pur_lyase	UniProtKB/TrEMBL
KEGG Report	rno:315150	UniProtKB/TrEMBL
NCBI Gene	315150	ENTREZGENE
PANTHER	ADENYLOSUCCINATE LYASE	UniProtKB/TrEMBL
	ADENYLOSUCCINATE LYASE	UniProtKB/TrEMBL
Pfam	ADSL_C	UniProtKB/TrEMBL
	Lyase_1	UniProtKB/TrEMBL
PhenoGen	Adsl	PhenoGen
PRINTS	ARGSUCLYASE	UniProtKB/TrEMBL
	FUMRATELYASE	UniProtKB/TrEMBL
PROSITE	FUMARATE_LYASES	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000018655	RatGTEx
SMART	ADSL_C	UniProtKB/TrEMBL
Superfamily-SCOP	L-Aspartase-like	UniProtKB/TrEMBL
UniProt	A0A8I5Y1I4_RAT	UniProtKB/TrEMBL
	A0A8I5ZTN5	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AM95_RAT	UniProtKB/TrEMBL
	A0A8I6GJ79	ENTREZGENE, UniProtKB/TrEMBL
	A6HSY1	ENTREZGENE, UniProtKB/TrEMBL
	D3ZW08_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-06-02	Adsl	adenylosuccinate lyase	test	test	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-05-08			Adsl	adenylosuccinate lyase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-26	Adsl	adenylosuccinate lyase	Adsl_predicted	adenylosuccinate lyase (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-12	Adsl_predicted	adenylosuccinate lyase (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways