Bphl (biphenyl hydrolase like) - Rat Genome Database

Name: Bphl
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Bphl (biphenyl hydrolase like) Rattus norvegicus

Analyze

Symbol:

Bphl

Name:

biphenyl hydrolase like

RGD ID:

1307572

Description:

Predicted to enable alpha-amino-acid esterase activity and poly(ADP-ribose) glycohydrolase activity. Predicted to be involved in ATP generation from poly-ADP-D-ribose. Predicted to be located in cytosol; mitochondrion; and nuclear body. Orthologous to human BPHL (biphenyl hydrolase like); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

biphenyl hydrolase-like (serine hydrolase); biphenyl hydrolase-like (serine hydrolase, breast epithelial mucin-associated antigen); LOC361239; MGC125077; valacyclovir hydrolase

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	BPHL (biphenyl hydrolase like)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Bphl (biphenyl hydrolase like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Bphl (biphenyl hydrolase like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	BPHL (biphenyl hydrolase like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	BPHL (biphenyl hydrolase like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Bphl (biphenyl hydrolase like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	BPHL (biphenyl hydrolase like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	BPHL (biphenyl hydrolase like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Bphl (biphenyl hydrolase like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	BPHL (biphenyl hydrolase like)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Bphl (biphenyl hydrolase like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	bphl (biphenyl hydrolase like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG5377	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	K01A2.5	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	bphl	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	31,006,283 - 31,042,631 (-)	NCBI		GRCr8
mRatBN7.2	17	30,800,939 - 30,837,277 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	30,799,629 - 30,837,288 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	30,614,893 - 30,651,139 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	32,218,639 - 32,254,884 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	30,610,637 - 30,646,883 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	31,498,877 - 31,535,172 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	31,498,883 - 31,535,172 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	33,392,063 - 33,428,242 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	37,143,275 - 37,181,166 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	37,146,050 - 37,184,007 (-)	NCBI
Celera	17	30,365,214 - 30,401,448 (-)	NCBI		Celera
Cytogenetic Map	17	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-dexrazoxane (ISO)

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

2-methylcholine (ISO)

3-chloropropane-1,2-diol (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

antimycin A (ISO)

aristolochic acid A (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

choline (ISO)

cisplatin (ISO)

clofibric acid (EXP)

cobalt dichloride (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

deguelin (ISO)

dibutyl phthalate (ISO)

dioxygen (ISO)

diuron (EXP)

doxorubicin (ISO)

fenpyroximate (ISO)

folic acid (ISO)

gentamycin (EXP)

glafenine (EXP)

inulin (ISO)

L-methionine (ISO)

methapyrilene (EXP)

methimazole (EXP)

methylmercury chloride (ISO)

N,N-diethyl-m-toluamide (EXP)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

nitrofen (EXP)

ozone (EXP)

paracetamol (ISO)

paraquat (EXP)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

permethrin (EXP)

picoxystrobin (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

sodium arsenite (EXP,ISO)

sodium dichromate (EXP)

sulfadimethoxine (EXP)

sunitinib (ISO)

tebufenpyrad (ISO)

temozolomide (ISO)

tetrachloromethane (EXP,ISO)

thapsigargin (ISO)

thifluzamide (ISO)

thioacetamide (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triptonide (ISO)

trovafloxacin (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

ATP generation from poly-ADP-D-ribose (ISO)

Cellular Component

cytosol (ISO)

mitochondrion (ISO)

nuclear body (ISO)

nucleoplasm (ISO)

nucleus (ISO)

Molecular Function

alpha-amino-acid esterase activity (ISO)

poly(ADP-ribose) glycohydrolase activity (ISO)

protein binding (ISO)

serine hydrolase activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	GOA pipeline	RGD automated data pipeline
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9074616	PMID:12477932	PMID:14651853	PMID:15450800	PMID:23376485	PMID:23474714	PMID:27257257

Genomics

Comparative Map Data

Bphl
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	31,006,283 - 31,042,631 (-)	NCBI		GRCr8
mRatBN7.2	17	30,800,939 - 30,837,277 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	30,799,629 - 30,837,288 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	30,614,893 - 30,651,139 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	32,218,639 - 32,254,884 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	30,610,637 - 30,646,883 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	31,498,877 - 31,535,172 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	31,498,883 - 31,535,172 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	33,392,063 - 33,428,242 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	37,143,275 - 37,181,166 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	37,146,050 - 37,184,007 (-)	NCBI
Celera	17	30,365,214 - 30,401,448 (-)	NCBI		Celera
Cytogenetic Map	17	p12	NCBI

BPHL
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	3,118,376 - 3,153,578 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	3,118,374 - 3,153,578 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	3,118,610 - 3,153,812 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	3,064,041 - 3,098,288 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	3,064,040 - 3,098,279	NCBI
Celera	6	4,347,797 - 4,382,302 (+)	NCBI		Celera
Cytogenetic Map	6	p25.2	NCBI
HuRef	6	2,989,338 - 3,023,543 (+)	NCBI		HuRef
CHM1_1	6	3,118,825 - 3,153,324 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	2,986,415 - 3,020,798 (+)	NCBI		T2T-CHM13v2.0

Bphl
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	34,221,611 - 34,258,055 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	34,221,580 - 34,258,057 (+)	Ensembl		GRCm39 Ensembl
GRCm38	13	34,037,585 - 34,074,074 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	34,037,597 - 34,074,074 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	34,129,510 - 34,165,943 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	34,045,106 - 34,081,539 (+)	NCBI		MGSCv36	mm8
Celera	13	35,167,133 - 35,203,461 (+)	NCBI		Celera
Cytogenetic Map	13	A3.3	NCBI
cM Map	13	14.02	NCBI

Bphl
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955465	10,089,608 - 10,120,588 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955465	10,093,342 - 10,120,588 (-)	NCBI	ChiLan1.0	ChiLan1.0

BPHL
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	17,749,382 - 17,786,539 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	13,739,388 - 13,786,846 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	2,946,472 - 2,993,624 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	3,049,546 - 3,083,169 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	3,049,549 - 3,083,169 (+)	Ensembl	panpan1.1		panPan2

BPHL
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	35	3,411,293 - 3,448,036 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	35	3,411,349 - 3,448,207 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	35	3,419,160 - 3,455,953 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	35	3,468,115 - 3,504,964 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	35	3,468,084 - 3,505,076 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	35	3,343,388 - 3,380,171 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	35	3,365,265 - 3,402,172 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	35	4,697,906 - 4,734,680 (+)	NCBI		UU_Cfam_GSD_1.0

Bphl
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	21,021,826 - 21,052,291 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936534	9,286,361 - 9,321,297 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936534	9,290,816 - 9,321,250 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BPHL
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	1,882,720 - 1,909,854 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	1,882,731 - 1,909,854 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	1,947,229 - 1,974,348 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BPHL
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	69,030,127 - 69,062,807 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	69,026,511 - 69,062,728 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	3,046,043 - 3,078,796 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bphl
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624756	21,763,058 - 21,788,432 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624756	21,762,752 - 21,790,825 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Bphl
139 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	41
Count of miRNA genes:	36
Interacting mature miRNAs:	39
Transcripts:	ENSRNOT00000023914
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10401807	Kidm52	Kidney mass QTL 52			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	1	31701463	Rat
70184	BpQTLcluster14	Blood pressure QTL cluster 14	3.38		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	1	31990913	Rat
631207	Niddm41	Non-insulin dependent diabetes mellitus QTL 41			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	1	37830672	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
1300123	Bp194	Blood pressure QTL 194	2.82		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	2115149	34551001	Rat
1354613	Kidm14	Kidney mass QTL 14	6.2		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	17	4299130	35837242	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4528038	49528038	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4528038	49528038	Rat
2303561	Bw91	Body weight QTL 91	2		body mass (VT:0001259)	body weight (CMO:0000012)	17	8868462	53868462	Rat
2300002	Iddm36	Insulin dependent diabetes mellitus QTL 36	1.98		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	9991286	40540197	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15330613	55836425	Rat
1354640	Scl32	Serum cholesterol level QTL 32	5.4		blood HDL cholesterol amount (VT:0000184)	blood high density lipoprotein cholesterol level (CMO:0000052)	17	15781592	60781592	Rat
1354659	Scl68	Serum cholesterol level QTL 68	3.9		blood VLDL cholesterol amount (VT:0005144)	blood very low density lipoprotein cholesterol level (CMO:0000648)	17	15781592	60781592	Rat
7394837	Memor18	Memory QTL 18			exploratory behavior trait (VT:0010471)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	17	18640182	63640182	Rat
1354628	Stl13	Serum triglyceride level QTL 13	3.8		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	21293039	60781592	Rat
70157	Niddm32	Non-insulin dependent diabetes mellitus QTL 32	4.34		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	22454924	50909196	Rat
61394	Bp8	Blood pressure QTL 8	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	23080567	59555013	Rat
7488966	Bp370	Blood pressure QTL 370		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	57246843	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23653184	68653184	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23653184	68653184	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23653184	68653184	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23653184	68653184	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	68653184	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23653184	70974005	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	24599340	69599340	Rat
4889891	Eae32	Experimental allergic encephalomyelitis QTL 32	4.8	0.0002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	27027949	36146731	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27027949	56836890	Rat
4889955	Bss93	Bone structure and strength QTL 93	4.4		tibia size trait (VT:0100001)	tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727)	17	27027949	60463643	Rat
2302377	Scl61	Serum cholesterol level QTL 61	4.36		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	17	27389946	53481766	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	28409147	73409147	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	28409147	73409147	Rat

Markers in Region

BF399928

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	30,805,565 - 30,805,718 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	31,503,501 - 31,503,653	NCBI	Rnor6.0
Rnor_5.0	17	33,396,571 - 33,396,723	UniSTS	Rnor5.0
RGSC_v3.4	17	37,149,098 - 37,149,250	UniSTS	RGSC3.4
Celera	17	30,369,841 - 30,369,993	UniSTS
RH 3.4 Map	17	372.3	UniSTS
Cytogenetic Map	17	p12	UniSTS

BF390609

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	30,805,659 - 30,805,823 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	31,503,595 - 31,503,758	NCBI	Rnor6.0
Rnor_5.0	17	33,396,665 - 33,396,828	UniSTS	Rnor5.0
RGSC_v3.4	17	37,149,192 - 37,149,355	UniSTS	RGSC3.4
Celera	17	30,369,935 - 30,370,098	UniSTS
RH 3.4 Map	17	374.2	UniSTS
Cytogenetic Map	17	p12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		23	31	23		23			31	31	16	3
Low	3	20	26	18	19	18	8	11	43	4	25	8	8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001037206	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039095883	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276586	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276587	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276588	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC105908	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473977	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215116	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218691	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000023914 ⟹ ENSRNOP00000023914

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	30,799,629 - 30,837,288 (-)	Ensembl
Rnor_6.0 Ensembl	17	31,498,883 - 31,535,172 (-)	Ensembl

RefSeq Acc Id:

NM_001037206 ⟹ NP_001032283

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	31,006,283 - 31,042,575 (-)	NCBI
mRatBN7.2	17	30,800,939 - 30,837,231 (-)	NCBI
Rnor_6.0	17	31,498,877 - 31,535,172 (-)	NCBI
Rnor_5.0	17	33,392,063 - 33,428,242 (-)	NCBI
RGSC_v3.4	17	37,143,275 - 37,181,166 (-)	RGD
Celera	17	30,365,214 - 30,401,448 (-)	RGD

Sequence:

show sequence

GGAGCTATGGCGACCGCAGCAGTCCACCCAGTAGCCCTGCGGTTACGGTTGCTCCTCTCACCCC
TGAAATCCCGGATCTGCGTACCCCAGGCCGAGCACGCAGCCACCTTCGGCACTGCAGTAACTTC
TGCCAAGGCGGCTGTGAATGGCATCCACCTGCATTACCAGCGAGTGGGAGAAGGGGAGCATGCA
GTCCTCCTACTTCCTGGGATGTTGGGAAGCGGAAAGACCGATTTTGCACCTCAGCTTCAGAGCC
TAAATAAGAAGCGCTTCACATTGGTGGCCTGGGATCCTCGAGGATACGGAGAGTCCAGACCCCC
AGATCGAGATTTCCCACGGGACTTTTTTGAGAGGGATGCAAAGGATGCTGTTGACTTGATGAAG
GCGCTGCAGTTCAAGCAGGTCTCCCTCCTGGGCTGGAGTGATGGCGGCATAACCGCGCTCATTG
CTGCTGCAAAGTACCCATCTTATATCCGCAAGATGGTGATCTGGGGGGCCAACGCCTACGTCAC
TGAGGAAGACAGCAGGATTTACCAGGGTATCCGAGATGTTTCTAAATGGAGTGAGAAGGCAAGG
AAACCCCTGGAAGCCCTATATGGACATGACTACTTTGCCAAAACCTGTGAGAAGTGGGTGGACG
GCATAAACCAGTTTAAACATCTGCCAGATGGTAACATCTGCCGGCACTTGCTGCCCCTGATCCA
GTGCCCTACCCTCATTGTGCACGGGGAGAAGGACCCATTGGTCCCACGCTTTCATGCTGACTTC
CTTCTAGAGCATGTGAAAGGGTCACGGTTGCACCTGATGCCAGAGGGCAAGCATAACCTACACT
TGCGCTTTGCGGATGAATTCAACAGGTTGGTAGAAGACTTTCTACAGTGAGAGCAGGAAACCTC
TGGTGTCTAGGAGATTCTGTATTGAAGGACCATGTCATTGCCTGTTACCTGGATGCTCGCAAAC
ACCTTCCCTCGCTTTTCACCTCAGTTCACAGACAGGCCTACCAGGCTTACTGCCTTCCCTGCAA
TGGGACTCTACACAAGCCGGGAAAATAGCAAACCCAAATCAGGTTGTAGCTTCAATAGCTGCAA
AAAACATGAACATTAGCATTTTTAACACTAACTTTCTATCATTGTCTTCAAAGTAAATTCTTAC
CATGATTTGTTTTCAAATAAATTTTATGGAAAACAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039095883 ⟹ XP_038951811

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	31,006,283 - 31,042,621 (-)	NCBI
mRatBN7.2	17	30,800,939 - 30,837,277 (-)	NCBI

RefSeq Acc Id:

XM_063276586 ⟹ XP_063132656

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	31,006,283 - 31,042,629 (-)	NCBI

RefSeq Acc Id:

XM_063276587 ⟹ XP_063132657

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	31,015,986 - 31,042,630 (-)	NCBI

RefSeq Acc Id:

XM_063276588 ⟹ XP_063132658

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	31,006,283 - 31,042,631 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001032283	(Get FASTA)	NCBI Sequence Viewer
	XP_038951811	(Get FASTA)	NCBI Sequence Viewer
	XP_063132656	(Get FASTA)	NCBI Sequence Viewer
	XP_063132657	(Get FASTA)	NCBI Sequence Viewer
	XP_063132658	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI05909	(Get FASTA)	NCBI Sequence Viewer
	EDL98319	(Get FASTA)	NCBI Sequence Viewer
	EDL98320	(Get FASTA)	NCBI Sequence Viewer
	EDL98321	(Get FASTA)	NCBI Sequence Viewer
	EDL98322	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000023914
	ENSRNOP00000023914.6

RefSeq Acc Id:

NP_001032283 ⟸ NM_001037206

- UniProtKB:

Q3B8N9 (UniProtKB/TrEMBL), F7FBS0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MATAAVHPVALRLRLLLSPLKSRICVPQAEHAATFGTAVTSAKAAVNGIHLHYQRVGEGEHAVL
LLPGMLGSGKTDFAPQLQSLNKKRFTLVAWDPRGYGESRPPDRDFPRDFFERDAKDAVDLMKAL
QFKQVSLLGWSDGGITALIAAAKYPSYIRKMVIWGANAYVTEEDSRIYQGIRDVSKWSEKARKP
LEALYGHDYFAKTCEKWVDGINQFKHLPDGNICRHLLPLIQCPTLIVHGEKDPLVPRFHADFLL
EHVKGSRLHLMPEGKHNLHLRFADEFNRLVEDFLQ

hide sequence

RefSeq Acc Id:

ENSRNOP00000023914 ⟸ ENSRNOT00000023914

RefSeq Acc Id:	XP_038951811 ⟸ XM_039095883
- Peptide Label:	isoform X3
- UniProtKB:	A6J7G9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063132658 ⟸ XM_063276588
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_063132656 ⟸ XM_063276586
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063132657 ⟸ XM_063276587
- Peptide Label:	isoform X2

Protein Domains

AB hydrolase-1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q3B8N9-F1-model_v2	AlphaFold	Q3B8N9	1-291	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700413

Promoter ID:

EPDNEW_R10937

Type:

initiation region

Name:

Bphl_1

Description:

biphenyl hydrolase like

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	31,535,181 - 31,535,241	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307572	AgrOrtholog
BioCyc Gene	G2FUF-9599	BioCyc
Ensembl Genes	ENSRNOG00000017577	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000023914	ENTREZGENE
	ENSRNOT00000023914.7	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.1820	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7388526	IMAGE-MGC_LOAD
InterPro	AB_hydrolase	UniProtKB/TrEMBL
	AB_hydrolase_1	UniProtKB/TrEMBL
KEGG Report	rno:361239	UniProtKB/TrEMBL
MGC_CLONE	MGC:125077	IMAGE-MGC_LOAD
NCBI Gene	361239	ENTREZGENE
PANTHER	VALACYCLOVIR HYDROLASE	UniProtKB/TrEMBL
	VALACYCLOVIR HYDROLASE	UniProtKB/TrEMBL
Pfam	Abhydrolase_1	UniProtKB/TrEMBL
	Abhydrolase_6	UniProtKB/TrEMBL
PhenoGen	Bphl	PhenoGen
PRINTS	ABHYDROLASE	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000017577	RatGTEx
Superfamily-SCOP	SSF53474	UniProtKB/TrEMBL
UniProt	A6J7G9	ENTREZGENE, UniProtKB/TrEMBL
	A6J7H0_RAT	UniProtKB/TrEMBL
	A6J7H1_RAT	UniProtKB/TrEMBL
	A6J7H2_RAT	UniProtKB/TrEMBL
	F7FBS0	ENTREZGENE, UniProtKB/TrEMBL
	Q3B8N9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-07-27	Bphl	biphenyl hydrolase like	Bphl	biphenyl hydrolase-like (serine hydrolase)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-26	Bphl	biphenyl hydrolase-like (serine hydrolase)	Bphl	biphenyl hydrolase-like (serine hydrolase, breast epithelial mucin-associated antigen)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Bphl	biphenyl hydrolase-like (serine hydrolase, breast epithelial mucin-associated antigen)	Bphl_predicted	biphenyl hydrolase-like (serine hydrolase, breast epithelial mucin-associated antigen) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Bphl_predicted	biphenyl hydrolase-like (serine hydrolase, breast epithelial mucin-associated antigen) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar