Stra6 (signaling receptor and transporter of retinol STRA6)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Stra6 (signaling receptor and transporter of retinol STRA6) Rattus norvegicus

Analyze

Symbol:

Stra6

Name:

signaling receptor and transporter of retinol STRA6

RGD ID:

1307551

Description:

Predicted to enable retinol transmembrane transporter activity. Involved in response to retinoic acid. Predicted to be part of protein-containing complex. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in syndromic microphthalmia 9. Orthologous to human STRA6 (signaling receptor and transporter of retinol STRA6); PARTICIPATES IN retinoic acid metabolic pathway; INTERACTS WITH 17beta-estradiol; 3,3',5,5'-tetrabromobisphenol A; 4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC363071; MGC114408; receptor for retinol uptake STRA6; retinol-binding protein receptor STRA6; RGD1307551; similar to retinoic acid-responsive protein; stimulated by retinoic acid 6; stimulated by retinoic acid gene 6; stimulated by retinoic acid gene 6 homolog; stimulated by retinoic acid gene 6 homolog (mouse); stimulated by retinoic acid gene 6 protein homolog

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

NCBI Annotation Information:

Annotation category: partial on reference assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	8	58,549,743 - 58,568,861 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	58,549,736 - 58,568,860 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	64,079,448 - 64,099,415 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	8	62,357,008 - 62,376,974 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	8	60,221,574 - 60,241,541 (+)	NCBI	Rnor_WKY
Rnor_6.0	8	62,925,364 - 62,944,438 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	62,925,357 - 62,944,437 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	62,701,454 - 62,720,528 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	61,920,772 - 61,939,791 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	61,939,822 - 61,958,845 (+)	NCBI
Celera	8	58,013,586 - 58,032,719 (+)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Anophthalmia (ISO)

Bardet-Biedl syndrome (ISO)

Bloom syndrome (ISO)

Cardiovascular Abnormalities (ISO)

colorectal adenocarcinoma (ISO)

colorectal cancer (ISO)

congenital heart disease (ISO)

Craniofacial Abnormalities (ISO)

diabetic retinopathy (ISO)

Diaphragmatic Hernia (ISO)

exfoliation syndrome (ISO)

Experimental Diabetes Mellitus (IEP)

genetic disease (ISO)

intellectual disability (ISO)

Isolated Microphthalmia with Coloboma (ISO)

lung disease (ISO)

microphthalmia (ISO)

persistent fetal circulation syndrome (ISO)

schizophrenia (ISO)

syndromic microphthalmia 5 (ISO)

syndromic microphthalmia 9 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3,3',5,5'-tetrabromobisphenol A (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid (EXP)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (ISO)

acrylamide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (EXP,ISO)

all-trans-retinol (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cefaloridine (EXP)

CGP 52608 (ISO)

chlordecone (ISO)

choline (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

copper atom (EXP)

copper(0) (EXP)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP)

diuron (EXP)

dorsomorphin (ISO)

entinostat (ISO)

ethyl methanesulfonate (ISO)

folic acid (ISO)

formaldehyde (ISO)

hydrogen sulfide (ISO)

L-methionine (ISO)

lead diacetate (EXP)

lipopolysaccharide (ISO)

mercury dichloride (EXP)

methamphetamine (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

ochratoxin A (EXP)

paclitaxel (EXP)

panobinostat (ISO)

pentane-2,3-dione (EXP)

pirinixic acid (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

SCH 23390 (EXP)

silicon dioxide (ISO)

sodium arsenite (ISO)

tamoxifen (ISO)

temozolomide (ISO)

thapsigargin (ISO)

titanium dioxide (ISO)

toluene (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triptonide (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adrenal gland development (ISO)

alveolar primary septum development (ISO)

artery morphogenesis (ISO)

blood vessel development (ISO)

camera-type eye development (ISO,ISS)

cognition (ISO)

developmental growth (ISO)

diaphragm development (ISO)

digestive tract morphogenesis (ISO)

ductus arteriosus closure (ISO)

ear development (ISO)

embryonic camera-type eye formation (ISO)

embryonic digestive tract development (ISO)

establishment of localization in cell (ISO)

eyelid development in camera-type eye (ISO)

face morphogenesis (ISO)

feeding behavior (ISO)

female genitalia development (ISO)

head development (ISO)

head morphogenesis (ISO)

heart development (ISO)

kidney development (ISO)

learning (ISO)

lung alveolus development (ISO)

lung development (ISO)

lung vasculature development (ISO)

neuromuscular process (ISO)

nose morphogenesis (ISO)

paramesonephric duct development (ISO)

positive regulation of behavior (ISO)

positive regulation of receptor signaling pathway via JAK-STAT (ISO)

pulmonary artery morphogenesis (ISO)

pulmonary valve morphogenesis (ISO)

response to retinoic acid (IEP)

retinol transport (IEA,ISO,ISS)

smooth muscle tissue development (ISO)

uterus morphogenesis (ISO)

ventricular septum development (ISO)

vitamin A import into cell (IBA)

vocal learning (ISO)

Cellular Component

cellular_component (ND)

plasma membrane (IBA,IEA,ISO,ISS)

protein-containing complex (IEA,ISO)

Molecular Function

molecular_function (ND)

protein binding (ISO)

retinal binding (IEA)

retinol binding (IEA)

retinol transmembrane transporter activity (IEA,ISO,ISS)

signaling receptor activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

retinoic acid metabolic pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The protective variant rs7173049 at LOXL1 locus impacts on retinoic acid signaling pathway in pseudoexfoliation syndrome.	Berner D, etal., Hum Mol Genet. 2019 Aug 1;28(15):2531-2548. doi: 10.1093/hmg/ddz075.
2.	Signaling by vitamin A and retinol-binding protein in regulation of insulin responses and lipid homeostasis.	Berry DC and Noy N, Biochim Biophys Acta. 2012 Jan;1821(1):168-76. Epub 2011 Jul 12.
3.	First implication of STRA6 mutations in isolated anophthalmia, microphthalmia, and coloboma: a new dimension to the STRA6 phenotype.	Casey J, etal., Hum Mutat. 2011 Dec;32(12):1417-26. doi: 10.1002/humu.21590. Epub 2011 Sep 29.
4.	Phenotypic spectrum of STRA6 mutations: from Matthew-Wood syndrome to non-lethal anophthalmia.	Chassaing N, etal., Hum Mutat. 2009 May;30(5):E673-81. doi: 10.1002/humu.21023.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Chrysin Ameliorates Malfunction of Retinoid Visual Cycle through Blocking Activation of AGE-RAGE-ER Stress in Glucose-Stimulated Retinal Pigment Epithelial Cells and Diabetic Eyes.	Kang MK, etal., Nutrients. 2018 Aug 8;10(8). pii: nu10081046. doi: 10.3390/nu10081046.
7.	Impaired Rhodopsin Generation in the Rat Model of Diabetic Retinopathy.	Malechka VV, etal., Am J Pathol. 2017 Oct;187(10):2222-2231. doi: 10.1016/j.ajpath.2017.06.007. Epub 2017 Jul 19.
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	Physiological insights into all-trans-retinoic acid biosynthesis.	Napoli JL Biochim Biophys Acta. 2012 Jan;1821(1):152-67. Epub 2011 May 19.
10.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
11.	Mutations in STRA6 cause a broad spectrum of malformations including anophthalmia, congenital heart defects, diaphragmatic hernia, alveolar capillary dysplasia, lung hypoplasia, and mental retardation.	Pasutto F, etal., Am J Hum Genet. 2007 Mar;80(3):550-60. doi: 10.1086/512203. Epub 2007 Jan 29.
12.	Novel STRA6 null mutations in the original family described with Matthew-Wood syndrome.	Pasutto F, etal., Am J Med Genet A. 2018 Jan;176(1):134-138. doi: 10.1002/ajmg.a.38529. Epub 2017 Nov 23.
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Comprehensive gene review and curation	RGD comprehensive gene curation
16.	Overexpression of the retinoic acid-responsive gene Stra6 in human cancers and its synergistic induction by Wnt-1 and retinoic acid.	Szeto W, etal., Cancer Res. 2001 May 15;61(10):4197-205.
17.	Acidic retinoids synergize with vitamin A to enhance retinol uptake and STRA6, LRAT, and CYP26B1 expression in neonatal lung.	Wu L and Ross AC, J Lipid Res. 2010 Feb;51(2):378-87. Epub 2009 Aug 20.

Additional References at PubMed

PMID:12477932	PMID:19500772	PMID:23105095	PMID:23839944

Genomics

Comparative Map Data

Stra6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	8	58,549,743 - 58,568,861 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	58,549,736 - 58,568,860 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	64,079,448 - 64,099,415 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	8	62,357,008 - 62,376,974 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	8	60,221,574 - 60,241,541 (+)	NCBI	Rnor_WKY
Rnor_6.0	8	62,925,364 - 62,944,438 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	62,925,357 - 62,944,437 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	62,701,454 - 62,720,528 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	61,920,772 - 61,939,791 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	61,939,822 - 61,958,845 (+)	NCBI
Celera	8	58,013,586 - 58,032,719 (+)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

STRA6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	74,179,466 - 74,212,259 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	15	74,179,466 - 74,212,267 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	74,471,807 - 74,502,046 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	72,258,860 - 72,282,245 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	72,258,862 - 72,282,245	NCBI
Celera	15	51,418,988 - 51,448,552 (-)	NCBI		Celera
Cytogenetic Map	15	q24.1	NCBI
HuRef	15	51,265,478 - 51,295,736 (-)	NCBI		HuRef
CHM1_1	15	74,590,002 - 74,620,238 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	72,045,386 - 72,075,628 (-)	NCBI		T2T-CHM13v2.0

Stra6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	57,971,076 - 58,061,287 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	57,971,071 - 58,061,279 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	58,063,793 - 58,154,004 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	58,063,788 - 58,153,996 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	57,976,895 - 58,001,804 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	57,927,486 - 57,952,090 (+)	NCBI		MGSCv36	mm8
Celera	9	55,363,368 - 55,388,212 (+)	NCBI		Celera
Cytogenetic Map	9	B	NCBI

Stra6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955450	3,580,662 - 3,602,600 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955450	3,579,081 - 3,602,538 (+)	NCBI	ChiLan1.0	ChiLan1.0

STRA6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	15	72,740,868 - 72,773,802 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	72,741,482 - 72,770,876 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	15	53,117,891 - 53,150,790 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

STRA6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	37,331,834 - 37,359,449 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	37,331,832 - 37,353,529 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	37,267,455 - 37,295,072 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	37,538,888 - 37,566,524 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	37,538,924 - 37,560,014 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	37,491,016 - 37,518,679 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	37,516,933 - 37,544,523 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	37,772,499 - 37,800,122 (-)	NCBI		UU_Cfam_GSD_1.0

Stra6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	115,376,111 - 115,490,544 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	33,224,859 - 33,245,030 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936471	33,224,174 - 33,245,076 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

STRA6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	59,318,011 - 59,347,266 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	59,317,930 - 59,347,274 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	63,936,184 - 63,965,508 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

STRA6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	9,275,317 - 9,311,302 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	9,278,303 - 9,311,475 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	132,311,962 - 132,346,794 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Stra6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624781	389,481 - 413,728 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624781	304,890 - 413,655 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Stra6
107 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	99
Count of miRNA genes:	66
Interacting mature miRNAs:	78
Transcripts:	ENSRNOT00000011074
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1558646	Swd5	Spike wave discharge measurement QTL 5	3.45	0.00036	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	8	14906751	59906751	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	16290444	61290444	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	22662330	67662330	Rat
2303564	Gluco43	Glucose level QTL 43	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	26130187	71130187	Rat
2303572	Insul13	Insulin level QTL 13	2		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	8	26130187	71130187	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
1300146	Rf17	Renal function QTL 17	2.9		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	8	28242912	73242912	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	29502665	70386295	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	61290444	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	61290444	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	30848154	61290444	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	30848154	61290444	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	30848154	61290444	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	61290444	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30856404	75856404	Rat
1582222	Epfw2	Epididymal fat weight QTL 2	3.2	0.0005	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	8	31737729	76737729	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	35551938	80551938	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	35582032	80582032	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	40713066	82925667	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	41866876	75097878	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	41866876	86866876	Rat
631216	Stl9	Serum triglyceride level QTL 9	4.71	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	8	41867010	70386132	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	46531639	119088624	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	8	46531639	119088624	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	8	46531639	119088624	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088624	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
2303570	Gluco48	Glucose level QTL 48	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	49805831	94805831	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	50095249	82460899	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	50095249	82460899	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	50095249	82460899	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	54043744	98968765	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	54237644	85365202	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	54237644	85365202	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	54237644	99103503	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	54259986	100382532	Rat

Markers in Region

AI059311

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	58,556,456 - 58,556,665 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	62,932,078 - 62,932,286	NCBI	Rnor6.0
Rnor_5.0	8	62,708,168 - 62,708,376	UniSTS	Rnor5.0
RGSC_v3.4	8	61,927,486 - 61,927,694	UniSTS	RGSC3.4
Celera	8	58,020,303 - 58,020,511	UniSTS
RH 3.4 Map	8	673.8	UniSTS
Cytogenetic Map	8	q24	UniSTS

BI284420

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	58,568,272 - 58,568,449 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	62,943,850 - 62,944,026	NCBI	Rnor6.0
Rnor_5.0	8	62,719,940 - 62,720,116	UniSTS	Rnor5.0
RGSC_v3.4	8	61,939,203 - 61,939,379	UniSTS	RGSC3.4
Celera	8	58,032,131 - 58,032,307	UniSTS
RH 3.4 Map	8	675.3	UniSTS
Cytogenetic Map	8	q24	UniSTS

Stra6

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	58,568,687 - 58,568,798 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	62,944,265 - 62,944,375	NCBI	Rnor6.0
Rnor_5.0	8	62,720,355 - 62,720,465	UniSTS	Rnor5.0
RGSC_v3.4	8	61,939,618 - 61,939,728	UniSTS	RGSC3.4
Celera	8	58,032,546 - 58,032,656	UniSTS
Cytogenetic Map	8	q24	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium									26	28	30
Low	2	12	12	6	12	6	1	1	48	7	11	11	1
Below cutoff	1	27	20	10	7	10	6	9					6

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001029924	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC097373	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000198	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000011074 ⟹ ENSRNOP00000011074

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	58,549,736 - 58,568,860 (+)	Ensembl
Rnor_6.0 Ensembl	8	62,925,357 - 62,944,437 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000090588 ⟹ ENSRNOP00000070968

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	58,549,736 - 58,568,860 (+)	Ensembl
Rnor_6.0 Ensembl	8	62,925,376 - 62,943,788 (+)	Ensembl

RefSeq Acc Id:

NM_001029924 ⟹ NP_001025095

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	8	58,549,743 - 58,568,861 (+)	NCBI
Rnor_6.0	8	62,925,364 - 62,944,438 (+)	NCBI
Rnor_5.0	8	62,701,454 - 62,720,528 (+)	NCBI
RGSC_v3.4	8	61,920,772 - 61,939,791 (+)	RGD
Celera	8	58,013,586 - 58,032,719 (+)	RGD

Sequence:

show sequence

GGAAATTGAGAAAGAAAGAAGAGCTGGAGCATGGAATCCCAGGCCTCTGAGAATGGAAGCCAGA
CCTCCTCCGGGGTGACAGATGACTACAGCAGCTGGTACATCGAGGAACCTCTAGGAGCTGAGGA
GGTGCAGCCAGAGGGGGTGAATCCCCTTTGCCAGCCCACTGTACCGCCTGCCCTGCACCATGCC
TGCTTGGCCTCACTGTCGCTCCTGGCTCTGCTGCTGCTGGCCTTACTGGTGAGACGTCGCAGGC
TTTGGCCACACTGTGCTCATTGCAGACCTGGACTGCCCAGCCCTGTGGATTTCTTGGCTGGGAA
CCGATCCTGGACAGTTCCTACTGCTGTCTTTGTGGCCCTCTTCAGCAATCTGTGCCTGTTGCTC
CCTGATGAGAACCCACTGCCTTTCCTGAACCGCACTGCAGCATCCAGTCCAGATGGAGAGCCGG
AGACATCAAGAGGGCCCTGGAAGCTCCTGGCTCTGCTCTACTACCCAGCCCTCTACTACCCTCT
GGCTGCCTGTGCTACGGCAGGGCACCGAGCTGCATACTTACTGGGTACTGTGCTATCTTGGGTT
CACGTCAGTGTTCAGGTCTGGCAGAGAGCAGAGTGTCCTCAGGACCCCAAGATCTACAAGCACT
ACTCCTTGCTGGCCTCCCTGCCTCTGCTTCTGAGTCTTGGATTCCTGAGCCTTTGGTATCCAGT
ACAAGTGGTGCAGAGTATCCGTCATCGGACAGGAGCAGGCTCCCAGGGGCTACAGACCAGCTAC
TCCGAGAAGTATCTGAGAGCCCTCCTCTGTCCAAAGAAGCTGGACAGCTGCTCCCATCCCGCCT
CCAAGCGTAGCCTTCTGTCTCGGGCTTGGGCCTTTTCCCAGCATTCCATCTACACTCCAGAGCC
AGGATTCTGCCTGCCCTTGAAGCTGGTGATCTCGGCCACCCTGACAGGAACAGCCACTTACCAG
GTGGCCCTGCTGTTGCTGGTGAGCGTGGTGCCTACTGTGCAGAAGGTGAGGGCAGGGATCACCA
CAGATGTCTCCTACCTGCTGGCGGGCTTTGGGATTGTGCTCTCTGAAGACAGGCAGGAGGTGGT
AGAGCTGGTGAAGCATCACCTATGGGCCGTGGAAGCATGTTATATCTCAGCTCTGGTCTTGTCC
TGCTCATTAACCTTCCTGCTTCTGATCCGCTCCCTGAGGACTCACAGGGCCAATCTTAAAGCAC
TGCACCGAGGGGCTGCCCTGGATCTGGGTCCCCCTCTTCAGAGTACTCACCCCTCTCGCCAAGC
CATAGTCTGCTGGATGAGCTTCAGTGCCTACCAGACGGCCTTCAGCTGCCTTGGGCTCCTGGTG
CAGCAGGTCATCTTCTTCCTGGGGACCACAATCCTGGCCTTCCTAGTGTTTGTGCCTTTACTCC
ATGGTAGGAACCTCTTGCTCCTCCGGTCCCTGGAATCCACATGGCCCTTCTGGCTGACTCTGGT
CTTGGCTGTAATCCTGCAGAACATAGCAGCCAATTGGGTCTTCCTAGAGTCTCACCACGGATAC
CCGGAGCTGACCAACCGGCGCATGCTCTGCGTAGCCACTTTTCTTCTCTTCCCCATCAACATGC
TGGTGGGAGCCATAATGGCTATTTGGCGGGTGCTCCTCTCTTCTCTCTACAACACTGTTCACCT
CGGCCAGATGGACCTCAGCCTGCTGCCGCAGAGAGCTGCCTCCCTGGATCCAGGCTATCACACA
TACCGAAACTTCCTGAGGATTGAGGCCAGCCAGTCACACCCAGGAGTCATAGCCTTCTGTGCCC
TGCTCCTTCATGTGCCAAGTCCACAGCCCCAGCCCCCACTGGCCCCCCAGGACAGCCTCAGACC
AGCAGCAGAAGAAGAAGGTATGCAATTGCTACAGACCAAGGACCTGATGGCCAAGGGAGCAGGA
CCCAAAGGCAGCCGGAGCAGGGCCCGGTGGGGTCTGGCCTACACATTGCTCCACAACCCAAGTC
TGCAGGCCTTTCGGAAGGCAGCCCTTACTAGTGCCAAGGCCAATGGCACCCAGCCCTGAGGGTG
AAGAAAACCACACCACCCTGCTTTTATGTGCTAAGGCACATTCTTGTCTACATCCTCCCTCTCA
TTCATGTCAGCAAGCCCCTCCCCCAGCAGCAACTCTGCCAACCAGGGGATCAGGGGACTGGAGT
CACTGTGTCTACACCACCAGCTTCCAGAGGACTTTGGTCTGTGCTTGTCCACAAGACTACCAGC
TAGGGCTCTAGAGGAAACAGCTAGTGGGTTCTTTGTCCTGGAACAGTCAGGGAAAGGGTGGGCA
CATTTAGGCCTCTCCTCCGCACACTGGCTCTGCCATCAGCTTGCTGGGCCTCAGTGAGGCCCCT
CTTACTCCCTGTTGGTAATGAAAATCCAGAATATCTCCTATCCCAGCTCGCCCCACCTCAGCCT
CCCACCATAAAGGTGGAGCCTGTGTGGGTTTCCTCTCTGCCCCAGCTCTCTGCTTCCTCTCTCT
TCCACTCCCGCCCCTTCTTGTGCAGCCAAGTCAGACTCCAAGAGGCCCCACGGAACTGCCCTCT
CCAAAAACCAGATTTTTTTTTGTAGTTTTAATGCTGTTAGTTGTCATGAAAGAAGTTAGTGTGC
TCTCTGTAATAAATGTGCCTCTGAGGAACACTCCTCCTCACTGGAGGAGGGCTCTCAGGGGAAC
CACTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001025095	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH97373	(Get FASTA)	NCBI Sequence Viewer
	EDL95664	(Get FASTA)	NCBI Sequence Viewer
	Q4QR83	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_001025095 ⟸ NM_001029924

- UniProtKB:

Q4QR83 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MESQASENGSQTSSGVTDDYSSWYIEEPLGAEEVQPEGVNPLCQPTVPPALHHACLASLSLLAL
LLLALLVRRRRLWPHCAHCRPGLPSPVDFLAGNRSWTVPTAVFVALFSNLCLLLPDENPLPFLN
RTAASSPDGEPETSRGPWKLLALLYYPALYYPLAACATAGHRAAYLLGTVLSWVHVSVQVWQRA
ECPQDPKIYKHYSLLASLPLLLSLGFLSLWYPVQVVQSIRHRTGAGSQGLQTSYSEKYLRALLC
PKKLDSCSHPASKRSLLSRAWAFSQHSIYTPEPGFCLPLKLVISATLTGTATYQVALLLLVSVV
PTVQKVRAGITTDVSYLLAGFGIVLSEDRQEVVELVKHHLWAVEACYISALVLSCSLTFLLLIR
SLRTHRANLKALHRGAALDLGPPLQSTHPSRQAIVCWMSFSAYQTAFSCLGLLVQQVIFFLGTT
ILAFLVFVPLLHGRNLLLLRSLESTWPFWLTLVLAVILQNIAANWVFLESHHGYPELTNRRMLC
VATFLLFPINMLVGAIMAIWRVLLSSLYNTVHLGQMDLSLLPQRAASLDPGYHTYRNFLRIEAS
QSHPGVIAFCALLLHVPSPQPQPPLAPQDSLRPAAEEEGMQLLQTKDLMAKGAGPKGSRSRARW
GLAYTLLHNPSLQAFRKAALTSAKANGTQP

hide sequence

RefSeq Acc Id:

ENSRNOP00000070968 ⟸ ENSRNOT00000090588

RefSeq Acc Id:

ENSRNOP00000011074 ⟸ ENSRNOT00000011074

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4QR83-F1-model_v2	AlphaFold	Q4QR83	1-670	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307551	AgrOrtholog
BioCyc Gene	G2FUF-30277	BioCyc
Ensembl Genes	ENSRNOG00000008312	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000011074	ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOP00000011074.7	UniProtKB/Swiss-Prot
	ENSRNOP00000070968.2	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000011074	ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOT00000011074.7	UniProtKB/Swiss-Prot
	ENSRNOT00000090588.2	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7444462	IMAGE-MGC_LOAD
InterPro	STRA6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:363071	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:114408	IMAGE-MGC_LOAD
NCBI Gene	363071	ENTREZGENE
PANTHER	COILED-COIL DOMAIN-CONTAINING PROTEIN 180	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR21444:SF16	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	RBP_receptor	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Stra6	PhenoGen
UniProt	A0A0H2UHG6_RAT	UniProtKB/TrEMBL
	A0A8L2R3C2_RAT	UniProtKB/TrEMBL
	Q4QR83	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-11-11	Stra6	signaling receptor and transporter of retinol STRA6	Stra6	stimulated by retinoic acid 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-03-01	Stra6	stimulated by retinoic acid 6	Stra6	stimulated by retinoic acid gene 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Stra6	stimulated by retinoic acid gene 6	Stra6	stimulated by retinoic acid gene 6 homolog (mouse)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Stra6	stimulated by retinoic acid gene 6 homolog (mouse)	RGD1307551	similar to retinoic acid-responsive protein; STRA6	Symbol and Name updated	1299863	APPROVED
2005-12-06	RGD1307551	similar to retinoic acid-responsive protein; STRA6	RGD1307551_predicted	similar to retinoic acid-responsive protein; STRA6 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1307551_predicted	similar to retinoic acid-responsive protein; STRA6 (predicted)	LOC363071_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC363071_predicted	similar to retinoic acid-responsive protein; STRA6 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations