Srxn1 (sulfiredoxin 1) - Rat Genome Database

Name: Srxn1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Srxn1 (sulfiredoxin 1) Rattus norvegicus

Analyze

Symbol:

Srxn1

Name:

sulfiredoxin 1

RGD ID:

1307332

Description:

Predicted to enable oxidoreductase activity, acting on a sulfur group of donors. Predicted to be involved in response to oxidative stress. Predicted to be located in cytosol. Orthologous to human SRXN1 (sulfiredoxin 1); INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Ab2-390; LOC296271; neoplastic progression 3; Npn3; sulfiredoxin 1 homolog; sulfiredoxin 1 homolog (S. cerevisiae); sulfiredoxin-1

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SRXN1 (sulfiredoxin 1)	HGNC	Ensembl, HomoloGene, NCBI, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Srxn1 (sulfiredoxin 1 homolog (S. cerevisiae))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Srxn1 (sulfiredoxin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SRXN1 (sulfiredoxin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SRXN1 (sulfiredoxin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Srxn1 (sulfiredoxin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SRXN1 (sulfiredoxin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SRXN1 (sulfiredoxin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Srxn1 (sulfiredoxin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SRXN1 (sulfiredoxin 1)	Alliance	DIOPT (HGNC)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	140,604,490 - 140,610,050 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	140,599,608 - 140,628,448 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	144,508,993 - 144,514,553 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	153,092,812 - 153,098,372 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	150,833,296 - 150,838,855 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	147,608,850 - 147,614,410 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	147,609,095 - 147,632,801 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	153,957,677 - 153,963,237 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	142,457,352 - 142,462,725 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	142,357,865 - 142,386,609 (+)	NCBI
Celera	3	139,357,182 - 139,362,742 (+)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brown-Vialetto-Van Laere syndrome 1 (ISO)

genetic disease (ISO)

Neurodevelopmental Disorders (ISO)

Polyglucosan Body Myopathy 1 with or without Immunodeficiency (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

(E)-cinnamyl alcohol (ISO)

(S)-colchicine (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

1H-pyrazole (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,4-D (ISO)

2,4-dinitrophenol (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-(chloromethyl)pyridine (ISO)

2-hydroxyethyl methacrylate (ISO)

2-hydroxypropanoic acid (ISO)

2-tert-butylhydroquinone (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-chloropropane-1,2-diol (EXP)

3-Hydroxybenzo[a]pyrene (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3-phenylprop-2-enal (ISO)

4,4'-methylene-bis-(2-chloroaniline) (ISO)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

4-nitro-1,2-phenylenediamine (ISO)

4-nitrophenol (ISO)

4-nitroquinoline N-oxide (ISO)

5-bromo-2'-deoxyuridine (ISO)

6-propyl-2-thiouracil (EXP,ISO)

acetamide (EXP)

acrylamide (ISO)

aflatoxin B1 (EXP,ISO)

Aflatoxin B2 alpha (ISO)

Aflatoxin G1 (ISO)

Aflatoxin G2 (ISO)

all-trans-retinoic acid (ISO)

allyl alcohol (ISO)

alpha-hexylcinnamaldehyde (ISO)

amoxicillin (ISO)

ampicillin (ISO)

andrographolide (ISO)

aphidicolin (ISO)

arachidonic acid (EXP)

aristolochic acid A (ISO)

arotinoid acid (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

azathioprine (ISO)

Bandrowski's base (ISO)

Bardoxolone methyl (ISO)

beauvericin (ISO)

benzene (ISO)

benzidine (ISO)

benzo[a]pyrene (ISO)

benzoic acid (ISO)

beta-naphthoflavone (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bleomycin A2 (ISO)

bleomycin A5 (ISO)

Bromochloroacetonitrile (ISO)

buta-1,3-diene (ISO)

butan-1-ol (ISO)

butylated hydroxyanisole (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

cadmium sulfate (ISO)

camptothecin (ISO)

cannabidiol (ISO)

captan (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

cerium trichloride (ISO)

CHIR 99021 (ISO)

chlordecone (ISO)

chloroacetaldehyde (ISO)

Chloroacetonitrile (ISO)

chloroprene (EXP,ISO)

choline (ISO)

cidofovir anhydrous (ISO)

ciglitazone (EXP)

cinnamyl alcohol (ISO)

cisplatin (EXP,ISO)

clobetasol (ISO)

clodronic acid (ISO)

cobalt dichloride (EXP,ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cortisol (ISO)

coumarin (EXP)

cyclosporin A (ISO)

cypermethrin (ISO)

cyproconazole (ISO)

cytarabine (ISO)

DDT (ISO)

decabromodiphenyl ether (EXP)

dexamethasone (ISO)

diarsenic trioxide (ISO)

diazinon (ISO)

dibenzo[a,l]pyrene (ISO)

Dibromoacetonitrile (ISO)

dibutyl phthalate (EXP)

dicamba (ISO)

dichloroacetic acid (ISO)

Dichloroacetonitrile (ISO)

diclofenac (ISO)

diethyl maleate (ISO)

dimethyl sulfoxide (EXP)

dioxygen (ISO)

diphenylcyclopropenone (ISO)

dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO)

diquat (ISO)

disulfiram (ISO)

diuron (EXP)

doramapimod (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (ISO)

enniatin (ISO)

entinostat (ISO)

epoxiconazole (ISO)

etacrynic acid (ISO)

ethanol (ISO)

ethionamide (ISO)

etoposide (ISO)

eugenol (ISO)

fenamidone (ISO)

fenofibrate (ISO)

fenvalerate (EXP)

flucloxacillin (ISO)

flutamide (EXP)

folic acid (ISO)

folpet (ISO)

formaldehyde (EXP,ISO)

fumonisin B1 (ISO)

furan (EXP,ISO)

gamma-hexachlorocyclohexane (ISO)

genistein (ISO)

gentamycin (EXP)

glutathione (EXP)

hexane (ISO)

hydralazine (ISO)

hydrogen peroxide (ISO)

hydroxyurea (ISO)

hypochlorous acid (ISO)

ibuprofen (ISO)

ifosfamide (ISO)

indometacin (ISO)

isoeugenol (ISO)

isoniazide (ISO)

ivermectin (ISO)

ketoconazole (EXP)

L-ascorbic acid (ISO)

L-ascorbic acid 2-phosphate (ISO)

L-methionine (ISO)

lead diacetate (ISO)

leflunomide (EXP,ISO)

levofloxacin (EXP)

lipopolysaccharide (ISO)

lomustine (ISO)

lutein (ISO)

menadione (ISO)

mercury dibromide (ISO)

mercury dichloride (EXP)

metam (ISO)

methapyrilene (ISO)

methyl methacrylate (ISO)

methyl methanesulfonate (ISO)

methyl salicylate (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

mitomycin C (ISO)

morphine (ISO)

N,N-diethyl-m-toluamide (EXP)

N-[3,5-bis(trifluoromethyl)phenyl]-5-chloro-2-hydroxybenzamide (ISO)

N-acetyl-L-cysteine (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-methylformamide (ISO)

N-nitrosodiethylamine (EXP,ISO)

n-propyl gallate (ISO)

naphthalene (EXP)

nefazodone (EXP)

nickel sulfate (ISO)

nimesulide (EXP)

nitrososulfamethoxazole (ISO)

ochratoxin A (ISO)

oxaliplatin (EXP)

ozone (ISO)

p-chloromercuribenzoic acid (ISO)

paclitaxel (ISO)

paracetamol (EXP,ISO)

paraquat (EXP,ISO)

pentachlorophenol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

permethrin (EXP,ISO)

phenobarbital (ISO)

phenol (ISO)

phenylmercury acetate (ISO)

phorone (EXP)

piperonyl butoxide (EXP)

pirinixic acid (ISO)

potassium bromate (ISO)

prednisolone (ISO)

propan-2-ol (ISO)

propiconazole (ISO)

Pyridostigmine bromide (EXP)

quercetin (EXP)

quinolin-8-ol (ISO)

rac-lactic acid (ISO)

reactive oxygen species (ISO)

resorcinol (ISO)

rotenone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sodium dodecyl sulfate (ISO)

Soman (EXP)

sotorasib (ISO)

streptozocin (ISO)

succimer (ISO)

sulfisoxazole (ISO)

sulforaphane (ISO)

sulindac (ISO)

sunitinib (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (EXP)

tetrachloroethene (ISO)

tetrachloromethane (EXP,ISO)

thapsigargin (ISO)

thioacetamide (EXP)

titanium dioxide (EXP)

topotecan (EXP)

trametinib (ISO)

trans-isoeugenol (ISO)

Trichloroacetonitrile (ISO)

trichloroethene (EXP,ISO)

triphenyl phosphate (EXP)

Triptolide (ISO)

troglitazone (ISO)

tunicamycin (ISO)

urethane (ISO)

valproic acid (ISO)

XAV939 (ISO)

zearalenone (ISO)

zinc oxide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular oxidant detoxification (IEA)

cellular response to oxidative stress (IBA)

response to oxidative stress (ISO)

Cellular Component

cytoplasm (IBA)

cytosol (ISO)

Molecular Function

ATP binding (IEA)

oxidoreductase activity, acting on a sulfur group of donors (ISO)

protein binding (ISO)

sulfiredoxin activity (IBA,IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15448164	PMID:16565085	PMID:19430206	PMID:22402332	PMID:23553940	PMID:25407820	PMID:25620665	PMID:25955519	PMID:26992405	PMID:28552673	PMID:33173963
PMID:33421493

Genomics

Comparative Map Data

Srxn1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	140,604,490 - 140,610,050 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	140,599,608 - 140,628,448 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	144,508,993 - 144,514,553 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	153,092,812 - 153,098,372 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	150,833,296 - 150,838,855 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	147,608,850 - 147,614,410 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	147,609,095 - 147,632,801 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	153,957,677 - 153,963,237 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	142,457,352 - 142,462,725 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	142,357,865 - 142,386,609 (+)	NCBI
Celera	3	139,357,182 - 139,362,742 (+)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

SRXN1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	646,615 - 653,200 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	646,615 - 653,200 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	627,259 - 633,844 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	575,259 - 581,890 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	575,269 - 581,890	NCBI
Celera	20	722,084 - 728,715 (-)	NCBI		Celera
Cytogenetic Map	20	p13	NCBI
HuRef	20	578,569 - 585,325 (-)	NCBI		HuRef
CHM1_1	20	627,286 - 634,040 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	20	690,889 - 697,474 (-)	NCBI		T2T-CHM13v2.0

Srxn1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	151,946,738 - 151,953,296 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	151,947,436 - 151,953,296 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	152,105,524 - 152,111,376 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	152,105,516 - 152,111,376 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	151,931,466 - 151,937,089 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	151,797,171 - 151,802,794 (+)	NCBI		MGSCv36	mm8
Celera	2	157,921,724 - 157,927,347 (+)	NCBI		Celera
Cytogenetic Map	2	G3	NCBI
cM Map	2	74.83	NCBI

Srxn1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955597	483,358 - 487,555 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955597	483,358 - 487,555 (-)	NCBI	ChiLan1.0	ChiLan1.0

SRXN1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	20	1,732,942 - 1,739,638 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	855,951 - 862,640 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	625,376 - 631,950 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	625,376 - 631,950 (-)	Ensembl	panpan1.1		panPan2

SRXN1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	20,232,608 - 20,238,838 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	20,232,607 - 20,237,154 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	19,885,276 - 19,891,640 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	20,923,866 - 20,930,218 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	20,923,866 - 20,930,153 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	20,199,129 - 20,205,485 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	20,304,875 - 20,311,233 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	20,735,939 - 20,742,311 (+)	NCBI		UU_Cfam_GSD_1.0

Srxn1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	169,441,639 - 169,484,737 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936485	17,873,286 - 17,877,783 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936485	17,873,283 - 17,879,746 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SRXN1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	34,582,440 - 34,589,300 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	34,582,377 - 34,589,308 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	39,382,631 - 39,389,562 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SRXN1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	55,866,050 - 55,870,568 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666078	8,080,707 - 8,087,095 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Srxn1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624741	1,724,554 - 1,730,059 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Srxn1
9 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	80
Count of miRNA genes:	72
Interacting mature miRNAs:	74
Transcripts:	ENSRNOT00000041456
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
5686842	Rf59	Renal function QTL 59			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	3	140069424	146976080	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
8552952	Pigfal13	Plasma insulin-like growth factor 1 level QTL 13			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	138799500	169034231	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	121056165	145956249	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
2298477	Eau4	Experimental allergic uveoretinitis QTL 4		0.0011	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	3	137398739	169034231	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat

Markers in Region

RH128232

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	140,609,767 - 140,609,981 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	147,614,128 - 147,614,341	NCBI	Rnor6.0
Rnor_5.0	3	153,962,955 - 153,963,168	UniSTS	Rnor5.0
RGSC_v3.4	3	142,462,452 - 142,462,665	UniSTS	RGSC3.4
Celera	3	139,362,460 - 139,362,673	UniSTS
Cytogenetic Map	3	q41	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	1		1						2		5
Low	2	36	55	40	19	40	7	10	66	33	26	9	7
Below cutoff		7	1	1		1	1	1	6	2	9	2	1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001047858	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY325205	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC167743	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474050	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000119	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000041456 ⟹ ENSRNOP00000041813

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	140,599,608 - 140,628,448 (+)	Ensembl
Rnor_6.0 Ensembl	3	147,609,095 - 147,632,801 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000115549 ⟹ ENSRNOP00000079019

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	140,599,608 - 140,628,448 (+)	Ensembl

RefSeq Acc Id:

NM_001047858 ⟹ NP_001041323

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	140,604,490 - 140,610,050 (+)	NCBI
Rnor_6.0	3	147,608,850 - 147,614,410 (+)	NCBI
Rnor_5.0	3	153,957,677 - 153,963,237 (+)	NCBI
RGSC_v3.4	3	142,457,352 - 142,462,725 (+)	RGD
Celera	3	139,357,182 - 139,362,742 (+)	NCBI

Sequence:

show sequence

CAGCGACCCGACGCGTCCATTAAGCGCATCGCGAGGGGGCGGCGGGGCGCCTCAGCGGGCAGCG
GGCAGCTAGAACAGCGTGGGACGTGGGGCTCTGGTCGAGCGGAGCGGGGGCCGATACATCACAG
CGTGAGCCGAGCCACTCGGTGGGGGCAAGCGCAGAACCGTCGCCCCCCCGCGGCCGCACGATGG
TACAGCCCGGCCGGGTAAAGAGGCCGGGTGGCGCTGTCCGCCAAGGAAGCAATATGGGGCTACG
CGCGGGTGGAGCTCTCCGGAGGGCGAGTGCGGGGCCTGGGGCGCCCGACGGTCAGGGACCCAGT
GGCGCGCAAGGAGGCAGCATCCACTCTGGCTGCATCGACACTGTGCACAACGTGCCAATCGCCG
TGCTCATCCGGCCGCTGCCGTCGGTGCTGGACCCGGTCAAGGTGCAGAGCCTCGTGGACACGAT
CCTGGAGGACCCTGACAGTGTGCCCCCCATCGACGTCCTCTGGATCAAAGGGGCCCAAGGCGGT
GACTACTACTACTCCTTTGGGGGCTGCCACCGCTATGCAGCCTACCAGCAGCTACAGAGAGAGA
CCATTCCTGCCAAGCTCGTGAGGTCTACCCTTTCAGACCTGAGGATGTACCTGGGTGCATCCAC
ACCAGACTTGCAGTAGCAACCTCCTGATACCCCACTCCCGCCTTTTCCACACCAGCACCACTTC
CTGGTGCTCAGAAGACACCTGCAGGCCCCCGTGGGCAGACGTTATAGAAGGAATATGTTCTTTT
CCTACTTAAGGAGGGGTGTCTGCCTCTTGGTGCCTCTGCACTAGCCCCCAGGGACTAGCTCCCA
AGAATGAGGGGGTTCCGTTCTTCAGTCTATGAAAAGATAACACGGCCTTGACCCTGATGGAGTA
CCAAGAGGAGGAAGTAAGAAAGATGGACTCGGAGACAAGGACTCTCCATTTTACTCTTTATGAT
ATCTTATCACTACATGAACTAGGTACTAGGAAGTGAAGGAAAACCTAGGTCACCGTGGCTTAAG
TGAGAGACGCTTGTTATCCGCATAGCCTGAACCCTGGAGCAGGTGACTAACACAGTATTATATC
TAACGGAGTGCCGTATCAATGCTCAGTGAGGGCGGGGCCTCCTCTCAGTAATCTCATTGCTCCT
TGCTTCGTAGTCACAAGATGGCTGCTGTGTTTCTAGAAATCATGTCTGTTGAGAAAGAACCCCG
ATAGACCAACTTCTGTCAGAAAGGAAAACCTCGTTCAGAGGTTTGCACAGTCGCCTTGGTCTGA
GCTGGCGACCATCGCCACTCACAGTTGCAAAGAAAGCAGACATTAGGAAACGTTATCACAGCTG
AGCGTGGCTGCCTTGTTCATTCCCTGGAATCCTGGAACAGGCCCTTTGCTCCCTGCAACACAAT
TGGGGATCCCATTGGCAGGAGAGGGAGGTAGCCTTTGCTACGAAACAAGCCATCCCCAGACTCA
ACAGCTAACCAAGTATTCACGTACCCGTGATTCTGTGGGTTAGCTAAGCTCCTTTGAGCAGCTC
TACTAGTGTGGCCTGGTCCTGCTCATGAGCCCAGTCACTTCTCACTTCAGCTGGGGCTGGTTAG
GCTGGGGTCACCCAGCCATTGTAGCAAGTGTTGGTTGCATCGGCTTGGTTAACCTTGTTGCCCC
TCTAGCAGGTCAGAGCAGGCTTATTTTCATGATGGCCTCAGGGTTCCAAGGGAGAGTAGTAGTG
ACTGAGCAGGACCTGGGGCGGTGGCTCGGCTGTTAAGAGCACTTACGTGGTGTTATGACACAGT
CATCCCTGTTCCAGATGACCTGATACCCTCTTCTAGCCTCTGTGGACACAGACATTACACATGT
GAGAAAAGCACTTTTTTCTTTTTTCTTTTTGAGACACTGGGTTTTTCTGTGTAGCTCTGGCTAT
CCTGGAACTCACTCTACAGAACCAGGCTAGCCTTGAACTCAGAGATCTGCCTCTACCACCTCCT
AAGTGCGGGTGTACTACTGTTACCCAGGGACATTTTTTTTTTCAGAGCTGACTGAACCCAGGGC
CTTGTGCTTGCTAGGCAAGCGCTCTACCACTAAGCTAAATCCCCAACCCCTGACTTTTTTTTTT
TAAAAGGTGACAAGGTTTCTTCAGCCCCGGTGCTAGGACTGTGTCTCCACTGGTCAGTTCATTC
CTTAGATTTCAGGGGTGCAAGTGGACCCAGCTCTCAATGGGAGGAACTATAAAGAACGTGGGGC
CATCTTTCATCACAGATGAATCTTGGTGGACAAGAGACAGAATTTCTCACTCCCACACATAAGC
ACTCCCGTTCACAAGTTTATTGATAAGCACACAGAGGGGCCAAGTCAGCCTTTAAGTAAGGTTC
TTAAAACCTAGAAGAAGTCGTGGCACGGTGCCTTCTAGAGCTGGGTACCCCACTCCAAGGATGA
TTCATAAGCAGAATGAGGTGGATAACGGGGCATTCAGAGGGGCTTCCGCAAACCCAGAGTCCAC
AAGGCAACGGAAGCAGCAGGGTGAGGTGGCACTTGCTACGCTTGTCATTTTCAAGCCTCTGTCT
TCCCAGCTCAATAGTGAGGTCACCAGCTTCCCCACCCACTGAGTGTCCCAGAGAATGAGATTGA
AAGGAATAAAGTGTATTGTGGTGCTGGATTGATTCTTAGGACCAAACAGAGACCAGGGAGAGAA
AGCACTTTAGCAGGTCAACCAGGACTCATACTGTCTGGGTCTTAGTTACCTTCCAGTTTGTAAT
CATATCTCTGGGGTGGGCTGGATGAAGATATATGGGAACCCTTTGGTCTCTGCAACTTTTCTGT
GAATCTAAAGTCATTCTAAAATAAAAGTTTATTTAATTAAAACACACACACAATGCAATGGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001041323	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI67743	(Get FASTA)	NCBI Sequence Viewer
	AAP92606	(Get FASTA)	NCBI Sequence Viewer
	EDL86084	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001041323 ⟸ NM_001047858
- UniProtKB:	A6KHM1 (UniProtKB/TrEMBL), B3DM86 (UniProtKB/TrEMBL)
- Sequence:	show sequence MVQPGRVKRPGGAVRQGSNMGLRAGGALRRASAGPGAPDGQGPSGAQGGSIHSGCIDTVHNVPI AVLIRPLPSVLDPVKVQSLVDTILEDPDSVPPIDVLWIKGAQGGDYYYSFGGCHRYAAYQQLQR ETIPAKLVRSTLSDLRMYLGASTPDLQ hide sequence

RefSeq Acc Id:

ENSRNOP00000041813 ⟸ ENSRNOT00000041456

RefSeq Acc Id:

ENSRNOP00000079019 ⟸ ENSRNOT00000115549

Protein Domains

ParB/Sulfiredoxin

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q7TP44-F1-model_v2	AlphaFold	Q7TP44	1-243	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307332	AgrOrtholog
BioCyc Gene	G2FUF-47281	BioCyc
Ensembl Genes	ENSRNOG00000031167	Ensembl, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000041813.3	UniProtKB/TrEMBL
	ENSRNOP00000079019.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000041456.5	UniProtKB/TrEMBL
	ENSRNOT00000115549.1	UniProtKB/TrEMBL
Gene3D-CATH	Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7455497	IMAGE-MGC_LOAD
InterPro	ParB/Sulfiredoxin_dom	UniProtKB/TrEMBL
	ParB/Sulfiredoxin_sf	UniProtKB/TrEMBL
	Sulfiredoxin	UniProtKB/TrEMBL
MGC_CLONE	MGC:187204	IMAGE-MGC_LOAD
NCBI Gene	296271	ENTREZGENE
PANTHER	PTHR21348	UniProtKB/TrEMBL
	SULFIREDOXIN-1	UniProtKB/TrEMBL
Pfam	ParBc	UniProtKB/TrEMBL
PhenoGen	Srxn1	PhenoGen
PIRSF	Sulfiredoxin	UniProtKB/TrEMBL
SMART	ParB	UniProtKB/TrEMBL
Superfamily-SCOP	SSF110849	UniProtKB/TrEMBL
UniProt	A0A8I5ZLX4_RAT	UniProtKB/TrEMBL
	A6KHM1	ENTREZGENE, UniProtKB/TrEMBL
	B3DM86	ENTREZGENE, UniProtKB/TrEMBL
	Q7TP44_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-01	Srxn1	sulfiredoxin 1	Srxn1	sulfiredoxin 1 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Srxn1	sulfiredoxin 1 homolog (S. cerevisiae)	Npn3	neoplastic progression 3	Symbol and Name updated	1299863	APPROVED
2005-12-06	Npn3	neoplastic progression 3	Npn3_predicted	neoplastic progression 3 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Npn3_predicted	neoplastic progression 3 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar