Cmtm5 (CKLF-like MARVEL transmembrane domain containing 5)

Gene: Cmtm5 (CKLF-like MARVEL transmembrane domain containing 5) Rattus norvegicus

Analyze

Symbol:

Cmtm5

Name:

CKLF-like MARVEL transmembrane domain containing 5

RGD ID:

1307045

Description:

Predicted to act upstream of or within negative regulation of myoblast differentiation. Predicted to be located in membrane. Orthologous to human CMTM5 (CKLF like MARVEL transmembrane domain containing 5); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

chemokine-like factor super family 5; CKLF-like MARVEL transmembrane domain-containing protein 5; Cklfsf5; LOC290214

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	32,382,171 - 32,385,288 (+)	NCBI		GRCr8
mRatBN7.2	15	28,412,624 - 28,415,304 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	28,412,624 - 28,415,287 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	30,258,294 - 30,260,974 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	31,405,496 - 31,408,176 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	29,648,215 - 29,650,895 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	33,600,016 - 33,602,839 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	33,600,102 - 33,602,834 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	37,487,105 - 37,489,785 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	33,038,905 - 33,041,691 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	33,054,563 - 33,057,392 (+)	NCBI
Celera	15	27,990,429 - 27,993,109 (+)	NCBI		Celera
Cytogenetic Map	15	p13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brain-Lung-Thyroid Syndrome (ISO)

genetic disease (ISO)

lysinuric protein intolerance (ISO)

Specific Granule Deficiency (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

6-propyl-2-thiouracil (EXP)

amitrole (EXP)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

carbamazepine (ISO)

clothianidin (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

ethanol (ISO)

folic acid (ISO)

ketamine (EXP)

methimazole (EXP)

methylmercury chloride (ISO)

morphine (ISO)

nicotine (ISO)

nitrofen (EXP)

pentanal (ISO)

perfluorohexanesulfonic acid (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

SB 431542 (ISO)

sulfadimethoxine (EXP)

triclosan (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of myoblast differentiation (ISO)

Cellular Component

membrane (IBA,IEA)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8889548	PMID:23844157

Genomics

Comparative Map Data

Cmtm5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	32,382,171 - 32,385,288 (+)	NCBI		GRCr8
mRatBN7.2	15	28,412,624 - 28,415,304 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	28,412,624 - 28,415,287 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	30,258,294 - 30,260,974 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	31,405,496 - 31,408,176 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	29,648,215 - 29,650,895 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	33,600,016 - 33,602,839 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	33,600,102 - 33,602,834 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	37,487,105 - 37,489,785 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	33,038,905 - 33,041,691 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	33,054,563 - 33,057,392 (+)	NCBI
Celera	15	27,990,429 - 27,993,109 (+)	NCBI		Celera
Cytogenetic Map	15	p13	NCBI

CMTM5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	23,376,771 - 23,379,772 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	23,376,773 - 23,379,772 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	23,846,255 - 23,848,981 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	22,915,857 - 22,918,821 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	22,915,856 - 22,918,821	NCBI
Celera	14	3,708,728 - 3,711,692 (+)	NCBI		Celera
Cytogenetic Map	14	q11.2	NCBI
HuRef	14	3,962,436 - 3,965,399 (+)	NCBI		HuRef
CHM1_1	14	23,844,689 - 23,847,653 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	17,577,688 - 17,580,788 (+)	NCBI		T2T-CHM13v2.0

Cmtm5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	55,173,927 - 55,176,734 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	55,173,718 - 55,176,731 (+)	Ensembl		GRCm39 Ensembl
GRCm38	14	54,936,176 - 54,943,045 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	54,936,261 - 54,939,274 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	55,555,307 - 55,558,114 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	53,890,679 - 53,893,486 (+)	NCBI		MGSCv36	mm8
Celera	14	52,742,660 - 52,745,257 (+)	NCBI		Celera
Cytogenetic Map	14	C3	NCBI
cM Map	14	28.0	NCBI

Cmtm5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955409	36,957,584 - 36,960,534 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955409	36,957,584 - 36,960,534 (-)	NCBI	ChiLan1.0	ChiLan1.0

CMTM5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	24,808,112 - 24,811,022 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	24,024,607 - 24,027,512 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	4,195,460 - 4,198,422 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	22,290,090 - 22,292,876 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	22,290,354 - 22,292,592 (+)	Ensembl	panpan1.1		panPan2

CMTM5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	3,625,246 - 3,627,964 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	3,625,309 - 3,661,444 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	3,573,221 - 3,576,174 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	3,732,741 - 3,735,692 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	3,725,891 - 3,747,853 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	3,424,297 - 3,427,248 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	3,485,573 - 3,488,727 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	3,747,768 - 3,750,729 (+)	NCBI		UU_Cfam_GSD_1.0

Cmtm5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	35,392,571 - 35,403,267 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936722	993,877 - 996,383 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936722	993,755 - 996,362 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CMTM5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	75,701,741 - 75,710,003 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	75,707,132 - 75,709,809 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	81,031,069 - 81,033,746 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CMTM5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	29	23,748,110 - 23,751,036 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	29	23,748,548 - 23,750,651 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666059	22,667,766 - 22,671,001 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cmtm5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624820	9,185,305 - 9,188,477 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624820	9,185,467 - 9,188,333 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cmtm5
9 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	113
Count of miRNA genes:	81
Interacting mature miRNAs:	102
Transcripts:	ENSRNOT00000022664
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354657	Despr13	Despair related QTL 13		0.0022	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	15	1	29912054	Rat
8552920	Pigfal8	Plasma insulin-like growth factor 1 level QTL 8	3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	15	1	34723002	Rat
8694361	Abfw6	Abdominal fat weight QTL 6	10.2	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	15	1	34723002	Rat
9589149	Insul29	Insulin level QTL 29	9.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	15	1	34723002	Rat
731170	Pur3	Proteinuria QTL 3	2.3	0.0005	urine protein amount (VT:0005160)	urine protein excretion rate (CMO:0000759)	15	1	41686771	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	42356671	Rat
2298549	Neuinf12	Neuroinflammation QTL 12	3.5		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	15	1	55302115	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	306329	45306329	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2266368	46921453	Rat
1582251	Gluco24	Glucose level QTL 24	3.2	0.0008	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	15	5530756	50530756	Rat
631273	Lecl2	Lens clarity QTL 2		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	15	10596089	55596089	Rat
2300167	Bmd63	Bone mineral density QTL 63	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
2300173	Bmd62	Bone mineral density QTL 62	12.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
2293688	Bss29	Bone structure and strength QTL 29	5.31	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	15	11111142	56111142	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	12496141	65205939	Rat
5685002	Bss103	Bone structure and strength QTL 103	2.8		tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	15	14481165	28469888	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	16725528	80672115	Rat
1331729	Rf42	Renal function QTL 42	3.071		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	15	17362897	73690657	Rat
631550	Bw7	Body weight QTL 7	3.6		body mass (VT:0001259)	body weight (CMO:0000012)	15	19856566	34924750	Rat
2324620	Coatc3	Coat color QTL 3			coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	15	19856566	46187442	Rat
10054130	Srcrt8	Stress Responsive Cort QTL 8	2.18	0.0085	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	22117933	67117933	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	22806240	98288169	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	22806240	98288169	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	22806240	98288169	Rat
1582214	Stl21	Serum triglyceride level QTL 21	3.1	0.022	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	15	28030665	82262678	Rat
1582227	Gluco30	Glucose level QTL 30	3.6	0.0003	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	15	28030665	82262678	Rat
1582228	Epfw3	Epididymal fat weight QTL 3	4.1	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat
1582242	Gluco28	Glucose level QTL 28	3.3	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	15	28030665	82262678	Rat
1582244	Bw79	Body weight QTL 79	4	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat

Markers in Region

AI715540

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	28,414,942 - 28,415,241 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	33,602,478 - 33,602,776	NCBI	Rnor6.0
Rnor_5.0	15	37,489,424 - 37,489,722	UniSTS	Rnor5.0
RGSC_v3.4	15	33,041,331 - 33,041,629	UniSTS	RGSC3.4
Celera	15	27,992,748 - 27,993,046	UniSTS
RH 3.4 Map	15	260.0	UniSTS
Cytogenetic Map	15	p13	UniSTS

BE120707

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	28,411,959 - 28,412,134 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	33,599,495 - 33,599,669	NCBI	Rnor6.0
Rnor_5.0	15	37,486,441 - 37,486,615	UniSTS	Rnor5.0
RGSC_v3.4	15	33,038,348 - 33,038,522	UniSTS	RGSC3.4
Celera	15	27,989,765 - 27,989,939	UniSTS
Cytogenetic Map	15	p13	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium									42
Low	3	35	6		4		6	7	26	8	31	7	6
Below cutoff		8	19	11	13	11	2	4	6	22	6	2	2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274120	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274121	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274122	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_001841254	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC115371	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AI715540	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CX569344	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM029909	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000022664 ⟹ ENSRNOP00000022664

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	28,412,624 - 28,415,287 (+)	Ensembl
Rnor_6.0 Ensembl	15	33,600,102 - 33,602,834 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000075965 ⟹ ENSRNOP00000068203

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	28,412,960 - 28,415,287 (+)	Ensembl
Rnor_6.0 Ensembl	15	33,600,337 - 33,602,745 (+)	Ensembl

RefSeq Acc Id:

NM_001106034 ⟹ NP_001099504

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	32,382,608 - 32,385,288 (+)	NCBI
mRatBN7.2	15	28,412,624 - 28,415,304 (+)	NCBI
Rnor_6.0	15	33,600,159 - 33,602,839 (+)	NCBI
Rnor_5.0	15	37,487,105 - 37,489,785 (+)	NCBI
RGSC_v3.4	15	33,038,905 - 33,041,691 (+)	RGD
Celera	15	27,990,429 - 27,993,109 (+)	NCBI

Sequence:

show sequence

ATCCCCCAACTCCTCAGGTTTCTTTCCCATGTCTTCCCTCCATGTTCCTTCTTTCCTTCTTCAG
GGTGGGTTAGGCCAGAGGAAGAGGAGGGTTAACCACCTCTCTCTCTCTCACCCTCCCCATGCTT
CCTAGGGGCCCTGCAGGCCAGTCTGGGCAGCTGGGTGAAGCTCATCTGGGCAAACTTGCCCTGG
GGACTGCCTTTCCCCAGAGTCCTACAGCAGACCCCAGCTTCACTTTCAGGCCCCTGTCTGCTTC
TCTAACCACATTTCTGTTTCCCTTCCTGGGCTGCTGGGAATCTGGTGAGGGAGAGTCCGTGTCC
CGTGAGCCTCACAGAGATGTTCAGTGTTTGGGATCGTCAGGAGCGGCCCCCAGAGGAAGGAACA
GCTGCAGGACTCCAGGGCTTCGGAGTGGACAAGACCTTCCTGTCTTCCCTCAAAGGCATCCTGC
TGGAAACTGAGCTGGCCCTGACCTTCATAATCTTCATTTGCTTCACGGCCTCCATCTCTGCCTA
CATGGCTGCAGCGTTGCTAGAGTTCTTCATCACACTGGCCTTCCTCTTCCTCTACGCCACCCAG
TGCTACCAGCGCTTCGACAGGCTTAACTGGCCTTGTCTGGACTTCCTCCGGTGTCTCAGCGCCA
TCATCATCTTCCTGGTGGTCTCCTTTGCAGCTGTGACCTCGAGGGAGGGAGCTGCCATTGCTGC
TTTTGTTTTTGGCATCATCCTGGTCTCTGTTTTTGCCTATGATGCGTTCAAGATCTACCGAACT
GAGTTGATGCCCAGGACCACAGAGGGGGACCAGCAGTGATTCCAGGACTACCTCGCTCCCACGA
CCAGACACAAGGAACCATAGAGCCCATCTGTGTCGTCTTTGAATTCACTGAACCCCGAGTGCCC
ACCATCTACTCCACGTCTTCAGAGATGTGCGCTTGAGAAATGCCAGGGACCTGTGGGAAGTGGT
GAAGTTCTGGGGGTCGGGGCAGGTTGCCATGCCTCCAAGTCACTCCCAAATTAAAAAAAAAAAA
TCCTAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063274120 ⟹ XP_063130190

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	32,382,171 - 32,385,288 (+)	NCBI

RefSeq Acc Id:

XM_063274121 ⟹ XP_063130191

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	32,382,171 - 32,385,288 (+)	NCBI

RefSeq Acc Id:

XM_063274122 ⟹ XP_063130192

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	32,382,171 - 32,385,288 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001099504	(Get FASTA)	NCBI Sequence Viewer
	XP_063130190	(Get FASTA)	NCBI Sequence Viewer
	XP_063130191	(Get FASTA)	NCBI Sequence Viewer
	XP_063130192	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM14206	(Get FASTA)	NCBI Sequence Viewer
	EDM14207	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000022664.7
	ENSRNOP00000068203.1

RefSeq Acc Id:	NP_001099504 ⟸ NM_001106034
- UniProtKB:	A6KGX8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MFSVWDRQERPPEEGTAAGLQGFGVDKTFLSSLKGILLETELALTFIIFICFTASISAYMAAAL LEFFITLAFLFLYATQCYQRFDRLNWPCLDFLRCLSAIIIFLVVSFAAVTSREGAAIAAFVFGI ILVSVFAYDAFKIYRTELMPRTTEGDQQ hide sequence

RefSeq Acc Id:

ENSRNOP00000068203 ⟸ ENSRNOT00000075965

RefSeq Acc Id:

ENSRNOP00000022664 ⟸ ENSRNOT00000022664

RefSeq Acc Id:	XP_063130191 ⟸ XM_063274121
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063130192 ⟸ XM_063274122
- Peptide Label:	isoform X3
- UniProtKB:	D3ZQ46 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063130190 ⟸ XM_063274120
- Peptide Label:	isoform X1

Protein Domains

MARVEL

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZQ46-F1-model_v2	AlphaFold	D3ZQ46	1-156	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307045	AgrOrtholog
BioCyc Gene	G2FUF-13764	BioCyc
Ensembl Genes	ENSRNOG00000016828	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000022664.8	UniProtKB/TrEMBL
	ENSRNOT00000075965.2	UniProtKB/TrEMBL
InterPro	Marvel	UniProtKB/TrEMBL
KEGG Report	rno:290214	UniProtKB/TrEMBL
NCBI Gene	290214	ENTREZGENE
PANTHER	CKLF-LIKE MARVEL TRANSMEMBRANE DOMAIN-CONTAINING PROTEIN 5	UniProtKB/TrEMBL
	MARVEL-CONTAINING POTENTIAL LIPID RAFT-ASSOCIATED PROTEIN	UniProtKB/TrEMBL
Pfam	MARVEL	UniProtKB/TrEMBL
PhenoGen	Cmtm5	PhenoGen
PROSITE	MARVEL	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000016828	RatGTEx
UniProt	A0A096MJN8_RAT	UniProtKB/TrEMBL
	A6KGX8	ENTREZGENE, UniProtKB/TrEMBL
	D3ZQ46	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-03	Cmtm5	CKLF-like MARVEL transmembrane domain containing 5	Cklfsf5_predicted	chemokine-like factor super family 5 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-12	Cklfsf5_predicted	chemokine-like factor super family 5 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar