Rpa3 (replication protein A3) - Rat Genome Database

Name: Rpa3
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Community Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease Coronavirus Disease Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Rpa3 (replication protein A3) Rattus norvegicus

Analyze

Symbol:

Rpa3

Name:

replication protein A3

RGD ID:

1306810

Description:

Predicted to enable damaged DNA binding activity and single-stranded DNA binding activity. Predicted to be involved in DNA metabolic process. Predicted to act upstream of or within regulation of cell population proliferation and regulation of mitotic cell cycle. Part of DNA replication factor A complex. Orthologous to human RPA3 (replication protein A3); PARTICIPATES IN mismatch repair pathway; nucleotide excision repair pathway; DNA replication pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC296883; replication protein A 14 kDa subunit

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RPA3 (replication protein A3)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rpa3 (replication protein A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rpa3 (replication protein A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RPA3 (replication protein A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RPA3 (replication protein A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rpa3 (replication protein A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RPA3 (replication protein A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RPA3 (replication protein A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rpa3 (replication protein A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SLC10A7 (solute carrier family 10 member 7)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	RPA3 (replication protein A3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Rpa3 (replication protein A3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rpa3 (replication protein A3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rpa3	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	36,304,649 - 36,307,755 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	36,304,651 - 36,307,709 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	41,272,230 - 41,275,262 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	37,198,431 - 37,201,463 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	35,609,727 - 35,612,758 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	34,279,320 - 34,282,351 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	34,279,320 - 34,282,351 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	34,139,498 - 34,142,529 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	33,304,334 - 33,307,365 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	33,422,871 - 33,425,905 (-)	NCBI
Celera	4	31,808,230 - 31,811,261 (-)	NCBI		Celera
Cytogenetic Map	4	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-quinic acid (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-chloropropane-1,2-diol (EXP)

3H-1,2-dithiole-3-thione (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aconitine (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bortezomib (ISO)

buspirone (EXP)

cadmium dichloride (ISO)

cannabidiol (ISO)

CGP 52608 (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

diethylstilbestrol (ISO)

doxorubicin (ISO)

Enterolactone (ISO)

enzyme inhibitor (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fenpyroximate (ISO)

fenthion (ISO)

folic acid (ISO)

fulvestrant (ISO)

furosemide (EXP)

gentamycin (EXP)

glafenine (EXP)

hydrogen peroxide (ISO)

hydroxytyrosol (ISO)

inulin (ISO)

ivermectin (ISO)

kaempferol (ISO)

lead diacetate (EXP)

methidathion (ISO)

methimazole (EXP)

N-(6-acetamidohexyl)acetamide (ISO)

nickel subsulfide (ISO)

ouabain (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

poly(propylene imine) macromolecule (ISO)

potassium dichromate (ISO)

quercetin (ISO)

Rebamipide (EXP)

resveratrol (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

sulfadimethoxine (EXP)

tamoxifen (ISO)

tetrachloromethane (EXP)

tolcapone (EXP)

topotecan (EXP)

trichloroethene (EXP)

triphenyl phosphate (EXP)

troglitazone (ISO)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

vincaleukoblastine (ISO)

vitamin E (ISO)

vorinostat (ISO)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

base-excision repair (IBA,ISO)

DNA repair (ISO)

DNA replication (IBA,IC,ISO)

double-strand break repair via homologous recombination (IBA,ISO)

mismatch repair (IBA,ISO)

nucleotide-excision repair (IBA,ISO)

regulation of cell population proliferation (ISO)

regulation of mitotic cell cycle (ISO)

Cellular Component

DNA replication factor A complex (IBA,IDA,ISO)

site of double-strand break (IBA)

Molecular Function

damaged DNA binding (IBA,ISO)

protein binding (ISO)

single-stranded DNA binding (IBA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

DNA replication pathway (IEA)

homologous recombination pathway of double-strand break repair (IEA)

mismatch repair pathway (IEA,ISO)

nucleotide excision repair pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Mechanisms and functions of DNA mismatch repair.	Li GM Cell Res. 2008 Jan;18(1):85-98.
4.	Calmodulin is involved in the induction of DNA polymerases alpha and delta activities in normal rat kidney cells activated to proliferate.	Lopez-Girona A, etal., Biochem Biophys Res Commun. 1995 Dec 14;217(2):566-74.
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	The multi-replication protein A (RPA) system--a new perspective.	Sakaguchi K, etal., FEBS J. 2009 Feb;276(4):943-63. doi: 10.1111/j.1742-4658.2008.06841.x. Epub 2009 Jan 12.

Additional References at PubMed

PMID:7700386	PMID:9430682	PMID:9765279	PMID:11927569	PMID:12477932	PMID:17765923	PMID:19010961	PMID:21482754

Genomics

Comparative Map Data

Rpa3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	36,304,649 - 36,307,755 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	36,304,651 - 36,307,709 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	41,272,230 - 41,275,262 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	37,198,431 - 37,201,463 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	35,609,727 - 35,612,758 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	34,279,320 - 34,282,351 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	34,279,320 - 34,282,351 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	34,139,498 - 34,142,529 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	33,304,334 - 33,307,365 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	33,422,871 - 33,425,905 (-)	NCBI
Celera	4	31,808,230 - 31,811,261 (-)	NCBI		Celera
Cytogenetic Map	4	q21	NCBI

RPA3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	7,636,518 - 7,718,607 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	7,636,518 - 7,718,607 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	7,676,149 - 7,758,238 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	7,643,100 - 7,724,763 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	7,449,816 - 7,531,478	NCBI
Celera	7	7,644,982 - 7,725,987 (-)	NCBI		Celera
Cytogenetic Map	7	p21.3	NCBI
HuRef	7	7,525,171 - 7,607,577 (-)	NCBI		HuRef
CHM1_1	7	7,676,293 - 7,757,838 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	7,754,317 - 7,837,139 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	7,723,782 - 7,804,410 (-)	NCBI

Rpa3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	8,255,936 - 8,259,141 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	8,255,936 - 8,259,173 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	8,255,936 - 8,259,141 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	8,255,936 - 8,259,173 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	8,205,936 - 8,209,141 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	8,205,937 - 8,209,113 (-)	NCBI		MGSCv36	mm8
Celera	6	8,397,638 - 8,400,833 (-)	NCBI		Celera
Cytogenetic Map	6	A1	NCBI
cM Map	6	3.53	NCBI

Rpa3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955432	14,723,751 - 14,727,290 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955432	14,723,933 - 14,727,356 (-)	NCBI	ChiLan1.0	ChiLan1.0

RPA3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	7	60,861,290 - 60,864,770 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	8,361,623 - 8,365,098 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	7,713,632 - 7,794,199 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	7,713,629 - 7,717,169 (-)	Ensembl	panpan1.1		panPan2

RPA3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	23,230,447 - 23,234,554 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	2,893,352 - 2,893,717 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	22,805,480 - 22,809,588 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	23,045,005 - 23,049,117 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	14	23,197,309 - 23,201,240 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	22,930,101 - 22,934,209 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	23,187,728 - 23,191,835 (-)	NCBI		UU_Cfam_GSD_1.0

Rpa3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	36,592,667 - 36,596,130 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936585	2,266,706 - 2,272,259 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936585	2,267,113 - 2,270,635 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RPA3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	77,910,881 - 77,937,060 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	77,910,876 - 77,914,872 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

RPA3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	50,570,027 - 50,574,270 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	50,570,751 - 50,574,216 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666042	53,812,402 - 53,816,643 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rpa3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624813	5,247,033 - 5,253,413 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624813	5,248,794 - 5,252,264 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rpa3
8 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	15
Count of miRNA genes:	12
Interacting mature miRNAs:	15
Transcripts:	ENSRNOT00000011123
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61415	Eae11	Experimental allergic encephalomyelitis QTL 11	2.9		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	4	1	39505420	Rat
634323	Hc2	Hypercalciuria QTL 2	2.15		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	4	210796	45210796	Rat
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5214602	78882945	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
2302371	Stl22	Serum triglyceride level QTL 22	5.15		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	57114705	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	65958103	Rat
631642	Stl2	Serum triglyceride level QTL 2	3.3		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5219178	56647776	Rat
631209	Bw2	Body weight QTL2	4.2		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	9940885	44463908	Rat
1300141	Bp178	Blood pressure QTL 178			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	10024901	39524530	Rat
6478724	Anxrr35	Anxiety related response QTL 35		0.00449	defecation behavior trait (VT:0010462)	defecation measurement (CMO:0000997)	4	10084089	55084089	Rat
6478766	Anxrr47	Anxiety related response QTL 47		0.09637	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	10084089	55084089	Rat
6478769	Anxrr48	Anxiety related response QTL 48		0.02514	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	10084089	55084089	Rat
8694374	Bw155	Body weight QTL 155	3.39	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	4	10084089	55084089	Rat
9590304	Scort17	Serum corticosterone level QTL 17	4.96	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	10084089	55084089	Rat
8552906	Pigfal3	Plasma insulin-like growth factor 1 level QTL 3			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	10084089	55084089	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	10814170	91360527	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
2303585	Bw86	Body weight QTL 86	4		body mass (VT:0001259)	body weight (CMO:0000012)	4	14678065	59678065	Rat
2313401	Anxrr27	Anxiety related response QTL 27			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	4	17933508	62933508	Rat
70222	Eae2	Experimental allergic encephalomyelitis QTL 2	4.3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	4	21333343	39505420	Rat
1354665	Stl10	Serum triglyceride level QTL 10	3.57		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	21333343	44463908	Rat
61412	Pia2	Pristane induced arthritis QTL 2	3.9		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	4	21333343	62278020	Rat
6909122	Insul22	Insulin level QTL 22	4.63		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	4	26907285	75585128	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	26907285	75585128	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	29494195	81006281	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	32583980	114627242	Rat
11530004	Niddm71	Non-insulin dependent diabetes mellitus QTL 71		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	4	32584199	52754138	Rat
8655949	Rf62	Renal function QTL 62	22		blood urea nitrogen amount (VT:0005265)	plasma urea nitrogen level (CMO:0000586)	4	34430119	44463908	Rat
8552782	Vie1	Viral induced encephalitis QTL 1	26.4		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
8552801	Bw143	Body weight QTL 143	7.3		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	34430484	82490359	Rat
8552809	Vie5	Viral induced encephalitis QTL 5	25.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	36303261	103194984	Rat

Markers in Region

RH141236

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	45,908,680 - 45,908,881 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	51,965,412 - 51,965,612	NCBI	Rnor6.0
Rnor_5.0	12	53,703,763 - 53,703,963	UniSTS	Rnor5.0
RGSC_v3.4	12	46,053,215 - 46,053,415	UniSTS	RGSC3.4
Celera	12	47,467,641 - 47,467,841	UniSTS
Cytogenetic Map	12	q16	UniSTS
Cytogenetic Map	4	q21	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	28	57	41	19	41	5	6	72	35	35	11	5
Low		15					3	5	2		6		3
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106584	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107259	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC168164	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228706	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000141	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000011123 ⟹ ENSRNOP00000011123

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	36,304,651 - 36,307,709 (-)	Ensembl
Rnor_6.0 Ensembl	4	34,279,320 - 34,282,351 (-)	Ensembl

RefSeq Acc Id:

NM_001106584 ⟹ NP_001100054

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	36,304,650 - 36,307,682 (-)	NCBI
Rnor_6.0	4	34,279,320 - 34,282,351 (-)	NCBI
Rnor_5.0	4	34,139,498 - 34,142,529 (-)	NCBI
RGSC_v3.4	4	33,304,334 - 33,307,365 (-)	RGD
Celera	4	31,808,230 - 31,811,261 (-)	RGD

Sequence:

show sequence

CCTGCGGGTTGTGAGTTTTGGCGGCAGAATCATGGTGGACATAATGGAACTCCCCAAAGCGCGC
GTCAACGCCAGCATGTTATCACAGTATATCGAACGACCCGTGTGCTTCGTGGGGAAGCTGGAAA
AGATTCATCCCACTGGAAAAATGTTTATTCTTTCAGATGGAGAAGGAAAGAATGGAACCATTGA
ATTGATGGAGCCACTGGATGAAGAAATCTCTGGAATCGTAGAAGTAGTCGGGAAGGTGACAGCC
AAGGCAACCATACTATGTGCATCTTATATCCTGTTTAAGGAAGATTGTAATCGCTTTGATCTTG
AACTTTACAATGAAGCTGTGAAAATTATCAATGAGTTTCCTCAGTTTTTTCCTTTAGGGCTTAC
ACAACATGAATGAGCTTCTTGAATTTCTTAAGATTGCCAGTAAGCTACATTGAAAGTTATTAAA
GAAGACTCCTTCAGTTTAAGGGAGAGACTCCTATAATTTCTAATATTTAATTTGCTTTTTTATA
TATATTTTTTGTAAATCTACTATGACAGTTTACATCTAAGTCTTTTTATAAATTTTTTAAAATC
GATACTTCAATATATGGTCTGAATAAAAAGAAAATTAAAAT

hide sequence

RefSeq Acc Id:

XM_039107259 ⟹ XP_038963187

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	36,304,649 - 36,307,755 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001100054	(Get FASTA)	NCBI Sequence Viewer
	XP_038963187	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM15057	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000011123
	ENSRNOP00000011123.5

RefSeq Acc Id:	NP_001100054 ⟸ NM_001106584
- UniProtKB:	D4A845 (UniProtKB/TrEMBL), A6IDX0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MVDIMELPKARVNASMLSQYIERPVCFVGKLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEIS GIVEVVGKVTAKATILCASYILFKEDCNRFDLELYNEAVKIINEFPQFFPLGLTQHE hide sequence

RefSeq Acc Id:

ENSRNOP00000011123 ⟸ ENSRNOT00000011123

RefSeq Acc Id:	XP_038963187 ⟸ XM_039107259
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A845-F1-model_v2	AlphaFold	D4A845	1-121	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692873

Promoter ID:

EPDNEW_R3398

Type:

initiation region

Name:

Rpa3_1

Description:

replication protein A3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	34,282,370 - 34,282,430	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306810	AgrOrtholog
BioCyc Gene	G2FUF-45660	BioCyc
Ensembl Genes	ENSRNOG00000008309	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000011123	ENTREZGENE
	ENSRNOT00000011123.6	UniProtKB/TrEMBL
Gene3D-CATH	2.40.50.140	UniProtKB/TrEMBL
InterPro	NA-bd_OB-fold	UniProtKB/TrEMBL
	Rep_factor-A_3	UniProtKB/TrEMBL
KEGG Report	rno:296883	UniProtKB/TrEMBL
NCBI Gene	296883	ENTREZGENE
PANTHER	REPLICATION PROTEIN A 14 KDA SUBUNIT	UniProtKB/TrEMBL
	REPLICATION PROTEIN A3	UniProtKB/TrEMBL
Pfam	Rep_fac-A_3	UniProtKB/TrEMBL
PhenoGen	Rpa3	PhenoGen
RatGTEx	ENSRNOG00000008309	RatGTEx
Superfamily-SCOP	Nucleic_acid_OB	UniProtKB/TrEMBL
UniProt	A6IDX0	ENTREZGENE, UniProtKB/TrEMBL
	D4A845	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Rpa3	replication protein A3	Rpa3_predicted	replication protein A3 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Rpa3_predicted	replication protein A3 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)