Advanced Search (OLGA)

Gene: C1qa (complement C1q A chain) Rattus norvegicus

Analyze

Symbol:

C1qa

Name:

complement C1q A chain

RGD ID:

1306716

Description:

Involved in response to iron ion. Located in synapse. Biomarker of iron deficiency anemia. Human ortholog(s) of this gene implicated in glomerulonephritis. Orthologous to human C1QA (complement C1q A chain); PARTICIPATES IN Chagas disease pathway; coagulation cascade pathway; complement system pathway; INTERACTS WITH 1,3-dinitrobenzene; 1-naphthyl isothiocyanate; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Adic; adiponectin c; complement C1q subcomponent subunit A; complement component 1, q subcomponent, A chain; complement component 1, q subcomponent, alpha polypeptide; LOC298566; MGC105755

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	C1QA (complement C1q A chain)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, PhylomeDB, Treefam
Mus musculus (house mouse):	C1qa (complement component 1, q subcomponent, alpha polypeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	C1qa (complement C1q A chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	C1QA (complement C1q A chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	C1qa (complement C1q A chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	C1QA (complement C1q A chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	C1QA (complement C1q A chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	C1qa (complement C1q A chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	C1QA (complement C1q A chain)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	C1qa (complement component 1, q subcomponent, alpha polypeptide)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	c1qa (complement component 1, q subcomponent, A chain)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	154,417,086 - 154,419,933 (-)	NCBI		GRCr8
mRatBN7.2	5	149,133,635 - 149,136,482 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	149,133,636 - 149,136,534 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	151,831,406 - 151,834,253 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	153,605,693 - 153,608,540 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	153,587,691 - 153,590,538 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	155,261,254 - 155,264,101 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	155,261,250 - 155,264,143 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	159,023,753 - 159,026,600 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	155,662,333 - 155,665,180 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	155,672,371 - 155,675,219 (-)	NCBI
Celera	5	147,531,382 - 147,534,229 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

3-hydroxy-3-methylglutaryl-CoA lyase deficiency (ISO)

basal cell carcinoma (ISO)

Brain Injuries (IEP)

C1q Deficiency (ISO)

C1q Deficiency 1 (ISO)

congenital disorder of glycosylation Ir (ISO)

COVID-19 (ISO)

Drug Hypersensitivity Syndrome (ISO)

epilepsy (ISS)

exanthem (ISO)

Experimental Liver Cirrhosis (ISO)

genetic disease (ISO)

glomerulonephritis (ISO)

hyperprolinemia type 2 (ISO)

hypersensitivity reaction type III disease (ISO)

IgA glomerulonephritis (ISO)

iron deficiency anemia (IEP)

membranoproliferative glomerulonephritis (ISO)

Parkinson's disease 6 (ISO)

Stevens-Johnson syndrome (ISO)

systemic lupus erythematosus (ISO,ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

(R)-lipoic acid (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1,3-dinitrobenzene (EXP)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-butoxyethanol (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3,3',5,5'-tetrabromobisphenol A (EXP)

3,7-dihydropurine-6-thione (EXP)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxy-TEMPO (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

acetamide (EXP)

aflatoxin B1 (EXP,ISO)

amitriptyline (EXP)

amitrole (EXP)

antirheumatic drug (ISO)

aristolochic acid A (EXP,ISO)

astaxanthin (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (EXP)

cannabidiol (ISO)

captan (ISO)

carbon nanotube (EXP,ISO)

chlordecone (ISO)

cisplatin (EXP)

coenzyme Q10 (ISO)

Cuprizon (EXP)

curcumin (ISO)

cyclophosphamide (ISO)

cyclosporin A (EXP)

dexamethasone (ISO)

dextran sulfate (ISO)

Dibutyl phosphate (ISO)

diclofenac (ISO)

diethylstilbestrol (ISO)

dioxygen (ISO)

diuron (EXP)

doramapimod (ISO)

doxorubicin (EXP,ISO)

ethanol (ISO)

flutamide (EXP)

folic acid (ISO)

folpet (ISO)

fumonisin B1 (ISO)

genistein (ISO)

gentamycin (EXP)

heptachlor (EXP)

indoles (EXP)

ketamine (EXP)

lansoprazole (EXP)

lipoic acid (ISO)

lipopolysaccharide (ISO)

lycopene (ISO)

medroxyprogesterone acetate (ISO)

mercaptopurine (EXP)

methcathinone (ISO)

methimazole (EXP)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP)

nickel sulfate (ISO)

nimesulide (EXP)

O-acetyl-L-carnitine (ISO)

ochratoxin A (EXP)

omeprazole (EXP)

ozone (ISO)

paclitaxel (EXP)

pantoprazole (EXP)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

purine-6-thiol (EXP)

rabeprazole (EXP)

resveratrol (EXP,ISO)

silicon dioxide (ISO)

sirolimus (EXP)

sodium arsenite (ISO)

sodium dichromate (EXP)

Soman (EXP)

streptozocin (EXP)

tacrolimus hydrate (ISO)

testosterone (EXP)

testosterone enanthate (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

toluene (EXP)

trimellitic anhydride (ISO)

trimethyltin (ISO)

triphenyl phosphate (EXP)

Triptolide (EXP)

troglitazone (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

astrocyte activation (IEA,ISO)

complement activation, classical pathway (IEA,ISO)

complement-mediated synapse pruning (IEA,ISO)

innate immune response (IEA)

microglial cell activation (IEA,ISO)

neuron remodeling (IEA,ISO)

response to iron ion (IEP)

synapse organization (ISO)

synapse pruning (ISO)

vertebrate eye-specific patterning (IEA,ISO)

Cellular Component

collagen trimer (IEA)

complement component C1q complex (IEA,ISO)

extracellular region (ISO)

extrinsic component of postsynaptic membrane (IEA,ISO)

extrinsic component of presynaptic membrane (IEA,ISO)

glutamatergic synapse (IEA,ISO)

postsynapse (ISO)

synapse (IDA,ISO)

Molecular Function

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Chagas disease pathway (IEA)

coagulation cascade pathway (IEA)

complement system pathway (IEA)

prion disease pathway (IEA)

Staphylococcus aureus infection pathway (IEA)

systemic lupus erythematosus pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Iron deficiency alters expression of genes implicated in Alzheimer disease pathogenesis.	Carlson ES, etal., Brain Res. 2008 Aug 7.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Comprehensive gene review and curation	RGD comprehensive gene curation
10.	The terminal pathway of the complement system is activated in focal penetrating but not in mild diffuse traumatic brain injury.	Rostami E, etal., J Neurotrauma. 2013 Dec 1;30(23):1954-65. doi: 10.1089/neu.2012.2583. Epub 2013 Oct 30.
11.	The classical complement cascade mediates CNS synapse elimination.	Stevens B, etal., Cell. 2007 Dec 14;131(6):1164-78. doi: 10.1016/j.cell.2007.10.036.
12.	Molecular basis of hereditary C1q deficiency associated with SLE and IgA nephropathy in a Turkish family.	Topaloglu R, etal., Kidney Int. 1996 Aug;50(2):635-42.

Additional References at PubMed

PMID:8464426	PMID:11901193	PMID:12477932	PMID:15269255	PMID:15489334	PMID:23150673	PMID:23376485	PMID:24006456	PMID:24939307	PMID:27033548	PMID:29476059

Genomics

Comparative Map Data

C1qa
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	154,417,086 - 154,419,933 (-)	NCBI		GRCr8
mRatBN7.2	5	149,133,635 - 149,136,482 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	149,133,636 - 149,136,534 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	151,831,406 - 151,834,253 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	153,605,693 - 153,608,540 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	153,587,691 - 153,590,538 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	155,261,254 - 155,264,101 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	155,261,250 - 155,264,143 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	159,023,753 - 159,026,600 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	155,662,333 - 155,665,180 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	155,672,371 - 155,675,219 (-)	NCBI
Celera	5	147,531,382 - 147,534,229 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

C1QA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	22,636,463 - 22,639,678 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	22,635,077 - 22,639,678 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	22,962,956 - 22,966,171 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	22,835,705 - 22,838,762 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	22,709,405 - 22,711,405	NCBI
Celera	1	21,287,826 - 21,290,883 (+)	NCBI		Celera
Cytogenetic Map	1	p36.12	NCBI
HuRef	1	21,207,463 - 21,210,520 (+)	NCBI		HuRef
CHM1_1	1	23,075,637 - 23,078,694 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	22,461,488 - 22,464,703 (+)	NCBI		T2T-CHM13v2.0

C1qa
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	136,623,227 - 136,626,155 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	136,623,228 - 136,626,114 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	136,895,916 - 136,898,844 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	136,895,917 - 136,898,803 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	136,451,831 - 136,454,759 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	136,167,994 - 136,170,836 (-)	NCBI		MGSCv36	mm8
Celera	4	135,103,233 - 135,106,157 (-)	NCBI		Celera
Cytogenetic Map	4	D3	NCBI
cM Map	4	69.05	NCBI

C1qa
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	2,752,970 - 2,756,488 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955452	2,753,362 - 2,756,220 (+)	NCBI	ChiLan1.0	ChiLan1.0

C1QA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	76,668,086 - 76,671,082 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	76,668,217 - 76,670,977 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	73,172,967 - 73,175,970 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	77,227,331 - 77,230,335 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	77,227,333 - 77,230,230 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	74,048,204 - 74,051,200 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	75,056,639 - 75,059,641 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	76,060,247 - 76,063,252 (-)	NCBI		UU_Cfam_GSD_1.0

C1qa
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	42,183,130 - 42,185,545 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	8,008,534 - 8,010,191 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	8,007,953 - 8,010,591 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

C1QA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	80,586,280 - 80,589,204 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	80,586,259 - 80,589,213 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	74,610,025 - 74,612,855 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

C1QA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	110,024,847 - 110,027,868 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666033	6,286,037 - 6,289,144 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

C1qa
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	7,363,567 - 7,366,617 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	7,363,615 - 7,366,408 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in C1qa
19 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	59
Count of miRNA genes:	53
Interacting mature miRNAs:	56
Transcripts:	ENSRNOT00000017385
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
2302369	Scl60	Serum cholesterol level QTL 60	3.13		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	143608201	161165651	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
1300119	Bp180	Blood pressure QTL 180	3.82		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	144358090	157869054	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	129132447	151006154	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
631263	Cm24	Cardiac mass QTL 24	3.5		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	143799107	158428037	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	143069996	166846814	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
2313096	Bmd78	Bone mineral density QTL 78	3.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	5	144377876	161317411	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat

Markers in Region

AI255395

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	149,133,994 - 149,134,107 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	155,261,614 - 155,261,726	NCBI	Rnor6.0
Rnor_5.0	5	159,024,113 - 159,024,225	UniSTS	Rnor5.0
RGSC_v3.4	5	155,662,693 - 155,662,805	UniSTS	RGSC3.4
Celera	5	147,531,742 - 147,531,854	UniSTS
Cytogenetic Map	5	q36	UniSTS

RH129734

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	149,133,781 - 149,133,963 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	155,261,401 - 155,261,582	NCBI	Rnor6.0
Rnor_5.0	5	159,023,900 - 159,024,081	UniSTS	Rnor5.0
RGSC_v3.4	5	155,662,480 - 155,662,661	UniSTS	RGSC3.4
Celera	5	147,531,529 - 147,531,710	UniSTS
RH 3.4 Map	5	1008.4	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	47	113	91	90	59	25	59	6	216	95	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001008515	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC113790	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC086605	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214296	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220086	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LT963069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000017385 ⟹ ENSRNOP00000017385

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	149,133,636 - 149,136,493 (-)	Ensembl
Rnor_6.0 Ensembl	5	155,261,250 - 155,264,143 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109333 ⟹ ENSRNOP00000076616

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	149,133,636 - 149,136,534 (-)	Ensembl

RefSeq Acc Id:

NM_001008515 ⟹ NP_001008515

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	154,417,086 - 154,419,933 (-)	NCBI
mRatBN7.2	5	149,133,635 - 149,136,482 (-)	NCBI
Rnor_6.0	5	155,261,254 - 155,264,101 (-)	NCBI
Rnor_5.0	5	159,023,753 - 159,026,600 (-)	NCBI
RGSC_v3.4	5	155,662,333 - 155,665,180 (-)	RGD
Celera	5	147,531,382 - 147,534,229 (-)	RGD

Sequence:

show sequence

ACATCCAGTGCGAGCGGACCACGGAGGCAGGAACATCATGGAGACCTCTCAGGGATGGCTGGTG
GCTTGTGTGCTGGCCGTGACCCTGGTATGGACAGTGGCTGAAGATGTCTGCAGAGCACCCAACG
GGAAGGACGGGGTTGCAGGAATTCCTGGCCGCCCAGGGAGGCCGGGTCTCAAAGGAGAGAGAGG
GGAGCCAGGAGCTGCCGGCATCCGGACCGGTATCCGAGGTCTTAAAGGAGACATGGGGGAATCT
GGGCCCCCTGGCAAACCCGGCAATGTGGGGTTCCCAGGGCCCACTGGGCCCCTGGGGAACAGCG
GCCCCCAAGGGTTGAAAGGTGTGAAAGGCAATCCGGGCAATATCAGGGACCAGCCCCGGCCAGC
TTTCTCAGCTATTCGGCAGAACCCACCGACGTATGGCAACGTGGTTGTCTTTGACAAGGTCCTC
ACCAACCAGGAGAATCCATACCAGAACCGCACAGGTCACTTCATCTGTGCGGTGCCCGGTTTCT
ATTACTTCACCTTCCAAGTGATCTCCAAGTGGGACCTTTGTCTGTCTATCGTGTCCTCCTCCCG
GGGCCAGCCCAGGAATTCCCTTGGTTTCTGTGACACCAACAGCAAGGGGCTCTTCCAGGTGTTA
GCAGGGGGCACTGTGCTTCAATTGCAACGAGGGGACGAGGTGTGGATTGAGAAGGACCCAGCAA
AGGGCCGCATTTACCAGGGTACTGAAGCCGACAGCATCTTCAGTGGATTCCTCATTTTTCCCTC
GGCCTGAGCTGGGTAGCTGCCCCACGTTCTGCCATCTCCTGCACTCCCTGTTGCGGGGCCCCAC
CCTGCATCCCTTCTCTCTGTACTCTGCAAAGTGAAGGGGCTGGGGTTTTAGCACTCTGGGGGAG
GGGCTGGCTCCGAGGGCACTGAGGACTGATGTCTCTCTGCACACGGCCCAGTGGTTTCTTTAAG
TACTTTCTGGAATAAATGACCCCATCTGTGTCTGTGGCTTGAAAAAAAAAAAAAAAAAAAAAAA
A

hide sequence

Protein Sequences


Protein RefSeqs	NP_001008515	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH86605	(Get FASTA)	NCBI Sequence Viewer
	EDL80827	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000017385.3
	ENSRNOP00000076616.1
GenBank Protein	P31720	(Get FASTA)	NCBI Sequence Viewer
	SOR70287	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001008515 ⟸ NM_001008515
- Peptide Label:	precursor
- UniProtKB:	Q5RJK1 (UniProtKB/Swiss-Prot), P31720 (UniProtKB/Swiss-Prot), A6ITC6 (UniProtKB/TrEMBL), A0A3B0J380 (UniProtKB/TrEMBL)
- Sequence:	show sequence METSQGWLVACVLAVTLVWTVAEDVCRAPNGKDGVAGIPGRPGRPGLKGERGEPGAAGIRTGIR GLKGDMGESGPPGKPGNVGFPGPTGPLGNSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPPTYG NVVVFDKVLTNQENPYQNRTGHFICAVPGFYYFTFQVISKWDLCLSIVSSSRGQPRNSLGFCDT NSKGLFQVLAGGTVLQLQRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA hide sequence

Ensembl Acc Id:

ENSRNOP00000017385 ⟸ ENSRNOT00000017385

Ensembl Acc Id:

ENSRNOP00000076616 ⟸ ENSRNOT00000109333

Protein Domains

C1q Collagen-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P31720-F1-model_v2	AlphaFold	P31720	1-245	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694175

Promoter ID:

EPDNEW_R4700

Type:

initiation region

Name:

C1qa_1

Description:

complement C1q A chain

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	155,264,095 - 155,264,155	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306716	AgrOrtholog
BioCyc Gene	G2FUF-39487	BioCyc
Ensembl Genes	ENSRNOG00000012807	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000017385.7	UniProtKB/Swiss-Prot
	ENSRNOT00000109333.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.120.40	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7316796	IMAGE-MGC_LOAD
InterPro	C1q_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Collagen	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Collagen/C1q_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Tumour_necrosis_fac-like_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:298566	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:105755	IMAGE-MGC_LOAD
NCBI Gene	298566	ENTREZGENE
PANTHER	EMILIN ELASTIN MICROFIBRIL INTERFACE-LOCATED PROTEIN ELASTIN MICROFIBRIL INTERFACER	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR15427:SF26	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	C1q	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Collagen	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	C1qa	PhenoGen
PRINTS	COMPLEMNTC1Q	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	C1Q	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000012807	RatGTEx
SMART	C1Q	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF49842	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A3B0J380	ENTREZGENE, UniProtKB/TrEMBL
	A6ITC6	ENTREZGENE, UniProtKB/TrEMBL
	C1QA_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q5RJK1	ENTREZGENE
UniProt Secondary	Q5RJK1	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-07-13	C1qa	complement C1q A chain	C1qa	complement component 1, q subcomponent, A chain	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-11-05	C1qa	complement component 1, q subcomponent, A chain	C1qa	complement component 1, q subcomponent, alpha polypeptide	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	C1qa	complement component 1, q subcomponent, alpha polypeptide	C1qa_predicted	complement component 1, q subcomponent, alpha polypeptide (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	C1qa_predicted	complement component 1, q subcomponent, alpha polypeptide (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)