Slc45a2 (solute carrier family 45, member 2)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Slc45a2 (solute carrier family 45, member 2) Rattus norvegicus

Analyze

Symbol:

Slc45a2

Name:

solute carrier family 45, member 2

RGD ID:

1306690

Description:

Predicted to enable glucose:proton symporter activity and sucrose:proton symporter activity. Predicted to be involved in lysosomal lumen pH elevation and melanin biosynthetic process from tyrosine. Predicted to act upstream of or within carbohydrate transport; developmental pigmentation; and proton transmembrane transport. Predicted to be located in melanosome membrane. Predicted to be active in membrane. Human ortholog(s) of this gene implicated in oculocutaneous albinism type IV and pigmentation disease. Orthologous to human SLC45A2 (solute carrier family 45 member 2); INTERACTS WITH acrylamide; bisphenol A; copper atom.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC310152; Matp; membrane associated transporter protein; membrane-associated transporter protein

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Candidate Gene For:

Gdil2

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	59,963,599 - 59,996,408 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	59,963,706 - 59,996,317 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	67,072,847 - 67,107,300 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	65,194,362 - 65,228,811 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	60,195,744 - 60,230,190 (+)	NCBI	Rnor_WKY
Rnor_6.0	2	60,966,671 - 60,999,398 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	60,966,789 - 60,999,398 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	83,685,368 - 83,717,569 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	60,349,773 - 60,383,838 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	60,278,089 - 60,311,585 (+)	NCBI
Celera	2	58,688,367 - 58,720,772 (-)	NCBI		Celera
Cytogenetic Map	2	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

alpha-methylacyl-CoA racemase deficiency (ISO)

basal cell carcinoma (ISO)

congenital bile acid synthesis defect 4 (ISO)

genetic disease (ISO)

hemorrhagic disease (ISO)

melanoma (ISO)

Neurodevelopmental Disorders (ISO)

Neurogenic Arthrogryposis Multiplex Congenita 4 with Agenesis of the Corpus Callosum (ISO)

Nonsyndromic Oculocutaneous Albinism (ISO)

oculocutaneous albinism (ISO,ISS)

oculocutaneous albinism type IV (ISO)

skin melanoma (ISO)

Skin/Hair/Eye Pigmentation, Variation In, 5 (ISO)

squamous cell carcinoma (ISO)

substance-related disorder (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

3-Iodothyronamine (ISO)

4-hydroxyphenyl retinamide (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

calcitriol (ISO)

CGP 52608 (ISO)

clothianidin (ISO)

colforsin daropate hydrochloride (ISO)

copper atom (EXP)

copper(0) (EXP)

cyclosporin A (ISO)

disodium selenite (ISO)

monosodium L-glutamate (ISO)

propanal (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

testosterone (ISO)

xylitol (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

carbohydrate transmembrane transport (ISO)

developmental pigmentation (ISO)

glucose transmembrane transport (IEA)

lysosomal lumen pH elevation (ISO)

melanin biosynthetic process from tyrosine (ISO)

proton transmembrane transport (ISO)

sucrose transport (ISO)

Cellular Component

cellular_component (ND)

melanosome membrane (ISO)

membrane (IBA)

Molecular Function

glucose:proton symporter activity (ISO)

molecular_function (ND)

protein binding (ISO)

sucrose:proton symporter activity (IBA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Oculocutaneous albinism type 4 is one of the most common types of albinism in Japan.	Inagaki K, etal., Am J Hum Genet. 2004 Mar;74(3):466-71. Epub 2004 Feb 11.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:11700328	PMID:25164149

Genomics

Comparative Map Data

Slc45a2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	59,963,599 - 59,996,408 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	59,963,706 - 59,996,317 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	67,072,847 - 67,107,300 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	65,194,362 - 65,228,811 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	60,195,744 - 60,230,190 (+)	NCBI	Rnor_WKY
Rnor_6.0	2	60,966,671 - 60,999,398 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	60,966,789 - 60,999,398 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	83,685,368 - 83,717,569 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	60,349,773 - 60,383,838 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	60,278,089 - 60,311,585 (+)	NCBI
Celera	2	58,688,367 - 58,720,772 (-)	NCBI		Celera
Cytogenetic Map	2	q16	NCBI

SLC45A2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	33,944,623 - 33,984,693 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	5	33,944,623 - 33,984,693 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	33,944,728 - 33,984,798 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	33,980,478 - 34,020,537 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	33,980,486 - 34,020,506	NCBI
Celera	5	33,833,208 - 33,873,213 (-)	NCBI		Celera
Cytogenetic Map	5	p13.2	NCBI
HuRef	5	33,922,738 - 33,962,743 (-)	NCBI		HuRef
CHM1_1	5	33,946,354 - 33,986,351 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	34,066,546 - 34,106,612 (-)	NCBI		T2T-CHM13v2.0

Slc45a2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	11,000,807 - 11,029,319 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	11,000,807 - 11,029,319 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	11,000,721 - 11,029,233 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	11,000,721 - 11,029,233 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	10,930,476 - 10,958,988 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	10,945,446 - 10,973,958 (+)	NCBI		MGSCv36	mm8
Celera	15	10,792,914 - 10,821,506 (+)	NCBI		Celera
Cytogenetic Map	15	A1	NCBI
cM Map	15	5.4	NCBI

Slc45a2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955426	19,498,942 - 19,530,628 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955426	19,498,942 - 19,530,628 (-)	NCBI	ChiLan1.0	ChiLan1.0

SLC45A2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	5	81,743,254 - 81,784,565 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	81,743,254 - 81,784,565 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	5	76,357,549 - 76,398,571 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

SLC45A2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	73,838,684 - 73,868,222 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	73,815,291 - 73,867,437 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	73,455,760 - 73,483,136 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	74,344,944 - 74,373,772 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	74,321,704 - 74,376,263 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	74,092,863 - 74,119,980 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	74,216,402 - 74,243,796 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	74,750,564 - 74,777,955 (+)	NCBI		UU_Cfam_GSD_1.0

Slc45a2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	224,231,872 - 224,276,922 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936518	7,095,038 - 7,137,277 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936518	7,094,949 - 7,139,961 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLC45A2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	19,956,366 - 20,023,289 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	16	19,958,315 - 20,002,198 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	20,718,138 - 20,759,105 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SLC45A2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	33,178,614 - 33,219,664 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	33,179,349 - 33,219,028 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666071	23,473,911 - 23,515,178 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slc45a2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624759	20,673,033 - 20,701,361 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624759	20,640,407 - 20,701,790 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Slc45a2
100 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	339
Count of miRNA genes:	205
Interacting mature miRNAs:	234
Transcripts:	ENSRNOT00000025490
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	5873687	102844969	Rat
731184	Mamtr4	Mammary tumor resistance QTL 4		0.0003	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	16491740	61491740	Rat
1357990	Ael1	Aortic elastin QTL 1	3.1	0.00091	aorta elastin amount (VT:0003905)	aortic elastin	2	19076825	64076825	Rat
731167	Glom4	Glomerulus QTL 4	2.4	0.0082	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	2	20304672	65304672	Rat
2300168	Bmd47	Bone mineral density QTL 47	6.6	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	2	20662448	65662448	Rat
10402051	Gdil2	Gastrointestinal dilation QTL 2			enteric ganglion morphology trait (VT:0001045)	length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836)	2	24903853	74786777	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	25413423	143657569	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	26917817	81754745	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	26917817	81754745	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	81754745	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	127469484	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	26917817	136917119	Rat
9590095	Sffal3	Serum free fatty acids level QTL 3	6.78	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	2	27157160	72157160	Rat
10755434	Coatc7	Coat color QTL 7		0.04794	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	30648065	75648065	Rat
10755436	Coatc8	Coat color QTL 8		0.02431	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	35023117	80023117	Rat
61371	Edpm1	Estrogen-dependent pituitary mass QTL 1	4	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	35134841	88029593	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	40067944	102785628	Rat
1300155	Bp174	Blood pressure QTL 174	4.09		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	42804607	60653831	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	157142209	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	43154682	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
2293676	Bmd19	Bone mineral density QTL 19	10.7	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	43162366	111362592	Rat
2293682	Bmd24	Bone mineral density QTL 24	8.9	0.0001	femur mineral mass (VT:0010011)	cortical volumetric bone mineral density (CMO:0001730)	2	43162366	111362592	Rat
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	43162366	148478373	Rat
631208	Bw1	Body weight QTL1	5.09		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	2	43171017	83575226	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1354592	Rf50	Renal function QTL 50	3.5		urine output (VT:0003620)	timed urine volume (CMO:0000260)	2	53822747	74786777	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
6480225	Gdil1	Gastrointestinal dilation QTL 1			enteric ganglion morphology trait (VT:0001045)	length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836)	2	56660879	74786777	Rat
1582246	Cm60	Cardiac mass QTL 60	5.8		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	57605612	76539510	Rat
1558648	Smcn1	Smooth muscle cell number QTL 1		0.039	blood vessel smooth muscle cell quantity (VT:0010525)	aorta smooth muscle cell count per unit vessel length (CMO:0001646)	2	59134147	127460910	Rat
5684990	Bmd82	Bone mineral density QTL 82	2.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	2	59324377	103795077	Rat
5684996	Bmd85	Bone mineral density QTL 85	4.7	0.024	tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	2	59324377	103795077	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	59324377	141596857	Rat
631500	Bp99	Blood pressure QTL 99	2.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	59324719	102755241	Rat
1578777	Stresp15	Stress response QTL 15	2	0.05	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	2	59846005	104846005	Rat

Markers in Region

D2Got316

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	59,969,102 - 59,969,279 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	60,972,186 - 60,972,362	NCBI	Rnor6.0
Rnor_5.0	2	83,711,996 - 83,712,172	UniSTS	Rnor5.0
RGSC_v3.4	2	60,355,170 - 60,355,346	UniSTS	RGSC3.4
Celera	2	58,715,199 - 58,715,375	UniSTS
Cytogenetic Map	2	q16	UniSTS

D2Got380

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	59,963,402 - 59,963,675 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	60,966,490 - 60,966,758	NCBI	Rnor6.0
Rnor_5.0	2	83,717,600 - 83,717,868	UniSTS	Rnor5.0
RGSC_v3.4	2	60,349,474 - 60,349,742	UniSTS	RGSC3.4
Celera	2	58,720,803 - 58,721,079	UniSTS
Cytogenetic Map	2	q16	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium
Low									1
Below cutoff	9	3	6	3	3	3	34	6	26	1	3

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107653	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590831	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102199	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128089	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474058	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000066	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000025490 ⟹ ENSRNOP00000025490

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	59,963,706 - 59,996,317 (+)	Ensembl
Rnor_6.0 Ensembl	2	60,966,789 - 60,999,398 (+)	Ensembl

RefSeq Acc Id:

NM_001107653 ⟹ NP_001101123

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	59,963,706 - 59,996,317 (+)	NCBI
Rnor_6.0	2	60,966,789 - 60,999,398 (+)	NCBI
Rnor_5.0	2	83,685,368 - 83,717,569 (-)	NCBI
RGSC_v3.4	2	60,349,773 - 60,383,838 (+)	RGD
Celera	2	58,688,367 - 58,720,772 (-)	RGD

Sequence:

show sequence

CCTCCTCCAGCCTCCCCATCTCCGTTGGCTGCTCAGACAGGCTTCATGTCAGACCCGGTTTGGA
GCACAAATCTGAGGACCGCGCTGGAAAGTTACCCTCTCCGTGGTCATGAGTGGAAGCAATGGGC
CAACTGACACCCGTGCCTATCAATCCTTAGCTGAGGATTGCCCCTTTGGGTCTGCGGAACAACC
CAAGAGATCCACGGGGAGACTCGTCATGCACAGCATGGCCATGTTCGGCCGAGAGTTTTGCTAT
GCGGTGGAGGCAGCTTACGTGACTCCAGTTCTGCTCAGCGTGGGCCTGCCTAAGAGTCTGTACA
GCATGGTGTGGCTCCTTAGTCCCATCCTGGGATTCCTGCTCCAGCCTGTGGTAGGGTCAGCTAG
TGATCACTGCAGAGCCAGGTGGGGTCGCCGGAGACCCTACATCCTGACTCTGGGTGTCATGATG
CTCTTGGGAATGGCTCTGTACCTCAATGGAGATGCTGCTGTATCAGCTTTGGTTGCTAACCCGA
GGCAGAAACTGGTCTGGGCCATAAGCATCACCATGATAGGTGTGGTTCTCTTCGATTTTTCTGC
TGACTTCATCGATGGGCCCATCAAAGCCTACTTATTTGATGTCTGCTCCCACCAGGACAAGGAG
AAGGGCCTCCACTACCATGCCCTCTTCACAGGTTTTGGAGGTGCTCTTGGTTACCTTTTGGGTG
CCATAGACTGGATGCATCTAGAGCTGGGAAAACTGCTGGGCACTGAATTCCAGGTCATGTTCTT
CTTCTCTGCCCTGGTTCTCACCTTGTGCTTCATCACGCACCTGTGCAGTATCCCTGAAGACCCA
CTCAGAGATGATGCAACAGACCCTCCCTTACAGCCAGACCCTCAGGGCTCGTCACTGTCAGCAG
ATGGGATGCCCCGATATGGTTCCATTGAGAAGGTTAAAAATGGAGATGCAGACACAGGACTGCC
AGTGCAGGGAGGGAAAAACAAGAAGCCTTCTGGACAGAGTCAGAGGACAATGTCGATGAAGTCA
CTTCTTCGGGCACTAGTGAACATGCCTTCCCATTATCGCTGCCTTTGCATCAGCCACCTCATTG
GATGGACTGCCTTCCTGTCAAACATGCTCTTCTTCACAGATTTCATGGGGCAGATCGTATACCA
TGGGGATCCCTACGGTGCACACAACTCCACAGAGTTTCTCATCTATGAAAGAGGAGTTGAGGTC
GGATGTTGGGGCTTGTGCATCAACTCGGTGTTTTCTTCAGTTTATTCTTACTTTCAGAAAGTTA
TGGTTTCCTATATTGGATTAAAAGGCCTTTATTTCATGGGATACTTGCTCTTTGGCCTGGGAAC
AGGATTCATAGGACTCTTTCCAAATGTGTACTCTACCCTGGTCCTCTGTTCTATGTTTGGGGTC
ATGTCCAGCACATTATACACCGTGCCTTTTAACCTCATTGCTGAGTACCACCGTGAGGAGGAGA
AAGAGAAGCAGCAGGAAGTCCCAGGAGGCCCTGACAACCACGGGCGAGGCAAAGGTGTGGACTG
CGCTGCTCTCACCTGCATGGTGCAGCTGGCTCAGATATTGGTTGGAGGTGGCCTGGGTTTCCTG
GTCAACATGGCTGGGAGTGTCGTCGTCGTGGTGATCACAGCCTCTGCAGTGGCACTGATAGGCT
GTTGCTTTGTGGCTCTCTTTGTAAGATATGTAGATTAGATTCATAAACATCACCTCAAACCTCA
GACAAAAGAAGCCCACAGCAAGAAATCGCTCTTTTCTCGGACTCTTCGGCAATGGGGACTGTAT
GCCCATGCTGGCACTGCAGCTTGCATGTGTGGTGGGATTGCCTGCCCCCTGCATCACATCCTTA
CTGTCCCTCAATGGGAGAGTCAAGTTCGGCTTCTCAAGAGGATTTCAAGCCTTCATAGCCTCTG
AGGAACAAATGCATCCTACCTGCGATGCTTCTAATGTAATTATAAAAGAACAATTTATACACCA
TAGGGAAATCACGTATTTCACCAAATTCAGAAGTACTTAAAATATTGCTGAGTTTTTTTTATCG
TGCTGATTTATACAAAGTTAATTGGCTCATAATTAATTCCCATTAATGTATGACATTCTCGACA
AACCTGAGTTGGATGTCTCATTCTGCAAGCTCTGCGATTCAAACATGTTCATCCATTTCATTGA
TGCAGTAAGCACATTTTTCTT

hide sequence

RefSeq Acc Id:

XM_039102199 ⟹ XP_038958127

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	59,963,599 - 59,996,408 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001101123	(Get FASTA)	NCBI Sequence Viewer
	XP_038958127	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL82981	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_001101123 ⟸ NM_001107653

- UniProtKB:

D3ZR99 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSGSNGPTDTRAYQSLAEDCPFGSAEQPKRSTGRLVMHSMAMFGREFCYAVEAAYVTPVLLSVG
LPKSLYSMVWLLSPILGFLLQPVVGSASDHCRARWGRRRPYILTLGVMMLLGMALYLNGDAAVS
ALVANPRQKLVWAISITMIGVVLFDFSADFIDGPIKAYLFDVCSHQDKEKGLHYHALFTGFGGA
LGYLLGAIDWMHLELGKLLGTEFQVMFFFSALVLTLCFITHLCSIPEDPLRDDATDPPLQPDPQ
GSSLSADGMPRYGSIEKVKNGDADTGLPVQGGKNKKPSGQSQRTMSMKSLLRALVNMPSHYRCL
CISHLIGWTAFLSNMLFFTDFMGQIVYHGDPYGAHNSTEFLIYERGVEVGCWGLCINSVFSSVY
SYFQKVMVSYIGLKGLYFMGYLLFGLGTGFIGLFPNVYSTLVLCSMFGVMSSTLYTVPFNLIAE
YHREEEKEKQQEVPGGPDNHGRGKGVDCAALTCMVQLAQILVGGGLGFLVNMAGSVVVVVITAS
AVALIGCCFVALFVRYVD

hide sequence

RefSeq Acc Id:

ENSRNOP00000025490 ⟸ ENSRNOT00000025490

RefSeq Acc Id:	XP_038958127 ⟸ XM_039102199
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZR99-F1-model_v2	AlphaFold	D3ZR99	1-530	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306690	AgrOrtholog
BioCyc Gene	G2FUF-54067	BioCyc
Ensembl Genes	ENSRNOG00000018759	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000025490	ENTREZGENE
	ENSRNOP00000025490.3	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000025490	ENTREZGENE
	ENSRNOT00000025490.5	UniProtKB/TrEMBL
Gene3D-CATH	1.20.1250.20	UniProtKB/TrEMBL
InterPro	MFS_trans_sf	UniProtKB/TrEMBL
KEGG Report	rno:310152	UniProtKB/TrEMBL
NCBI Gene	310152	ENTREZGENE
PhenoGen	Slc45a2	PhenoGen
Superfamily-SCOP	MFS_gen_substrate_transporter	UniProtKB/TrEMBL
UniProt	D3ZR99	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Slc45a2	solute carrier family 45, member 2	Slc45a2_predicted	solute carrier family 45, member 2 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Slc45a2_predicted	solute carrier family 45, member 2 (predicted)	Matp_predicted	membrane associated transporter protein (predicted)	Symbol and Name updated	1299863	APPROVED
2005-01-12	Matp_predicted	membrane associated transporter protein (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIA

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIA

Imported Disease Annotations - OMIM