Advanced Search (OLGA)

Gene: Clic2 (chloride intracellular channel 2) Rattus norvegicus

Analyze

Symbol:

Clic2

Name:

chloride intracellular channel 2

RGD ID:

1306580

Description:

Predicted to enable chloride channel activity and glutathione peroxidase activity. Predicted to be involved in chloride transport; negative regulation of ryanodine-sensitive calcium-release channel activity; and regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum. Predicted to be located in cytosol; nucleoplasm; and plasma membrane. Predicted to be part of chloride channel complex. Predicted to be active in cytoplasm and membrane. Orthologous to human CLIC2 (chloride intracellular channel 2); PARTICIPATES IN cimetidine pharmacodynamics pathway; esomeprazole pharmacodynamics pathway; famotidine pharmacodynamics pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl; 3,7-dihydropurine-6-thione.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

chloride intracellular channel protein 2; glutaredoxin-like oxidoreductase CLIC2; glutaredoxin-like peroxidase CLIC2; LOC294141; MGC108828

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CLIC2 (chloride intracellular channel 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Clic2 (chloride intracellular channel 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CLIC2 (chloride intracellular channel 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CLIC2 (chloride intracellular channel 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Clic2 (chloride intracellular channel 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CLIC2 (chloride intracellular channel 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CLIC2 (chloride intracellular channel 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Clic2 (chloride intracellular channel 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	LRTM1 (leucine rich repeats and transmembrane domains 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CLIC2 (chloride intracellular channel 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	clic2 (chloride intracellular channel 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Clic	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	exc-4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	exl-1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	154,630 - 169,655 (+)	NCBI		GRCr8
mRatBN7.2	20	149,337 - 164,375 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	148,907 - 164,355 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	163,856 - 179,662 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	167,322 - 183,128 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	157,735 - 172,759 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	295,338 - 310,363 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	295,250 - 310,380 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	289,420 - 304,445 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	66,518 - 81,543 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	66,517 - 81,536 (+)	NCBI
Celera	20	1,021,508 - 1,036,650 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adrenoleukodystrophy (ISO)

autistic disorder (ISO)

autosomal hemophilia A (ISO)

Barth syndrome (ISO)

cerebral creatine deficiency syndrome 1 (ISO)

dyskeratosis congenita (ISO)

Emery-Dreifuss muscular dystrophy (ISO)

Experimental Liver Cirrhosis (ISO)

factor VIII deficiency (ISO)

favism (ISO)

immunodeficiency 33 (ISO)

paraplegia (ISO)

periventricular nodular heterotopia (ISO)

Splenomegaly (ISO)

Waisman syndrome (ISO)

X-linked intellectual disability-cardiomegaly-congestive heart failure syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2-palmitoylglycerol (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,7-dihydropurine-6-thione (EXP)

3-chloropropane-1,2-diol (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

alpha-Zearalanol (EXP)

antirheumatic drug (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

CGP 52608 (ISO)

cyclosporin A (ISO)

DDE (ISO)

decabromodiphenyl ether (ISO)

diarsenic trioxide (ISO)

diethylstilbestrol (EXP)

diuron (EXP)

endosulfan (EXP)

ethyl methanesulfonate (ISO)

formaldehyde (ISO)

furan (EXP)

genistein (EXP)

gentamycin (EXP)

graphite (EXP)

mercaptopurine (EXP)

methyl methanesulfonate (ISO)

N,N-diethyl-m-toluamide (EXP)

N-nitrosodiethylamine (EXP)

oxaliplatin (EXP)

paracetamol (EXP)

perfluorooctanoic acid (EXP)

permethrin (EXP)

phenylephrine (EXP)

progesterone (ISO)

purine-6-thiol (EXP)

rotenone (EXP)

silicon dioxide (ISO)

sodium arsenite (ISO)

thioacetamide (EXP)

topotecan (EXP)

vinclozolin (EXP)

vincristine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

cellular oxidant detoxification (IEA)

chloride transmembrane transport (IEA)

chloride transport (IBA,IEA)

monoatomic ion transmembrane transport (IEA)

monoatomic ion transport (IEA)

regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion (ISO)

regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum (ISO)

Cellular Component

chloride channel complex (IEA)

cytoplasm (IBA,IEA,ISO)

cytosol (ISO)

membrane (IBA,IEA)

monoatomic ion channel complex (IEA)

nucleoplasm (ISO)

plasma membrane (ISO)

Molecular Function

chloride channel activity (IBA,IEA)

glutathione peroxidase activity (ISO)

glutathione transferase activity (ISO)

oxidoreductase activity (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

cimetidine pharmacodynamics pathway (ISO)

esomeprazole pharmacodynamics pathway (ISO)

famotidine pharmacodynamics pathway (ISO)

lansoprazole pharmacodynamics pathway (ISO)

nizatidine pharmacodynamics pathway (ISO)

omeprazole pharmacodynamics pathway (ISO)

pantoprazole pharmacodynamics pathway (ISO)

pirenzepine pharmacodynamics pathway (ISO)

rabeprazole pharmacodynamics pathway (ISO)

ranitidine pharmacodynamics pathway (ISO)

roxatidine acetate pharmacodynamics pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
4.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:12477932	PMID:15147738	PMID:15489334	PMID:15916532	PMID:34229297

Genomics

Comparative Map Data

Clic2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	154,630 - 169,655 (+)	NCBI		GRCr8
mRatBN7.2	20	149,337 - 164,375 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	148,907 - 164,355 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	163,856 - 179,662 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	167,322 - 183,128 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	157,735 - 172,759 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	295,338 - 310,363 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	295,250 - 310,380 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	289,420 - 304,445 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	66,518 - 81,543 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	66,517 - 81,536 (+)	NCBI
Celera	20	1,021,508 - 1,036,650 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

CLIC2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	155,276,211 - 155,334,614 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	155,276,211 - 155,334,657 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	X	154,505,500 - 154,563,923 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	154,158,694 - 154,217,180 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	X	154,070,159 - 154,127,661	NCBI
Celera	X	154,664,011 - 154,722,432 (-)	NCBI		Celera
Cytogenetic Map	X	q28	NCBI
HuRef	X	143,049,088 - 143,107,752 (-)	NCBI		HuRef
CHM1_1	X	154,416,162 - 154,475,622 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	X	153,513,523 - 153,571,950 (-)	NCBI		T2T-CHM13v2.0

Clic2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955594	374,208 - 393,389 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955594	374,332 - 393,802 (+)	NCBI	ChiLan1.0	ChiLan1.0

CLIC2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	X	155,241,784 - 155,350,478 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	X	155,245,392 - 155,354,086 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	X	144,742,839 - 144,851,524 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	X	154,581,649 - 154,641,515 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	X	154,581,649 - 154,641,515 (-)	Ensembl	panpan1.1		panPan2

CLIC2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	123,268,867 - 123,291,467 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	X	123,268,867 - 123,291,467 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	108,256,144 - 108,278,751 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	126,397,663 - 126,420,289 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	X	126,397,666 - 126,420,733 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	X	122,138,186 - 122,160,792 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	124,660,596 - 124,683,207 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	124,381,022 - 124,403,633 (-)	NCBI		UU_Cfam_GSD_1.0

Clic2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	X	120,156,502 - 120,186,481 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936927	514,899 - 543,693 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936927	514,989 - 543,691 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CLIC2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	X	125,546,467 - 125,570,523 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	X	125,546,451 - 125,560,059 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	X	142,872,444 - 142,885,806 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CLIC2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	X	129,564,187 - 129,606,324 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	X	129,560,658 - 129,606,438 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666065	67,544,925 - 67,587,038 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Clic2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624963	21,115 - 47,757 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Clic2
424 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	16
Count of miRNA genes:	16
Interacting mature miRNAs:	16
Transcripts:	ENSRNOT00000000955
Prediction methods:	Miranda
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7387283	Uae44	Urinary albumin excretion QTL 44		0.1712	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	20	1	26123605	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
724519	Bp144	Blood pressure QTL 144		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	20	1	3624629	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat

Markers in Region

D20Rhw1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	157,756 - 157,908 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	303,758 - 303,909	NCBI	Rnor6.0
Rnor_5.0	20	297,840 - 297,991	UniSTS	Rnor5.0
RGSC_v3.4	20	74,938 - 75,089	UniSTS	RGSC3.4
Celera	20	1,029,929 - 1,030,080	UniSTS
Cytogenetic Map	20	p12	UniSTS

D20Got100

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	157,750 - 157,910 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	303,752 - 303,911	NCBI	Rnor6.0
Rnor_5.0	20	297,834 - 297,993	UniSTS	Rnor5.0
RGSC_v3.4	20	74,932 - 75,091	UniSTS	RGSC3.4
Celera	20	1,029,923 - 1,030,082	UniSTS
Cytogenetic Map	20	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001009651	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC135704	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088182	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474093	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227497	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231721	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234033	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000955 ⟹ ENSRNOP00000000955

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	148,907 - 164,355 (+)	Ensembl
Rnor_6.0 Ensembl	20	295,250 - 310,380 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114425 ⟹ ENSRNOP00000082018

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	149,367 - 164,306 (+)	Ensembl

RefSeq Acc Id:

NM_001009651 ⟹ NP_001009651

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	154,630 - 169,655 (+)	NCBI
mRatBN7.2	20	149,337 - 164,362 (+)	NCBI
Rnor_6.0	20	295,338 - 310,363 (+)	NCBI
Rnor_5.0	20	289,420 - 304,445 (+)	NCBI
RGSC_v3.4	20	66,518 - 81,543 (+)	RGD
Celera	20	1,021,508 - 1,036,650 (+)	RGD

Sequence:

show sequence

GGAAAATAAATCAAGAGCTTCTTTTAGTGTCTAGAACTTTCCACATCCCAATCCTGCAAGAGGA
AAGATTGGCCCAGGTTTGACTCGGTGAACAAGTTAAACTCTCAGAACATCGACATTCCATGCAA
TTTTGGAAATAACTCAAGGAAGAGTCCACGAGTGTCCTGGCTTCACAAAGACGCTGGGGGCTGA
CGATTGACAGTAAAAGGAGATGGCAAGCTTAGCGCTCAACACCCAAGCAGACCCTGAAATTGAG
CTCTTTGTGAAGGCTGGAAGTGACGGAGAAAGTATTGGAAACTGTCCTTTCTGCCAACGCCTTT
TTATGATACTCTGGCTTAAGGGAGTTAAATTTAATGTGACTACTATTGATACAGCCAGAAAACC
TGAAGAACTGAAGGACTTAGCCCCAGGTACCAACCCACCATTCTTGATATATAACAAAGAGTTG
AAAACAGACTTCATTAAAATTGAGGAGTTTCTAGAGAAGACACTCGCTCCTCCAAGGTATCCTC
ATCTGAGTCCCAAGTACAAGGAATCTTTCGATGTGGGCTGTAATCTCTTTGCCAAATTTTCTGC
GTACATTAAGAATACACAAAAGGAAGCAAATAAGAATTTTGAAAAATCTCTGCTTAGAGAATTT
AAACGTTTGGATGACTACTTAAATACCCCACTTCTGGATGAAATTGATCCTGACAGCACCGAGG
AACGTACACTTTCCAGAAGACTGTTCTTGGATGGGGATCAACTAACACTGGCTGACTGTAGTTT
GTTGCCCAAACTGAACATTATTAAAGTTGCTGCGAAGAAGTACCGTGACTTTGACATTCCAGCA
GAATTCTCAGGAGTCTGGCGCTATCTCCACAATGCCTACGCCCGTGAAGAATTTGCCCACACAT
GTCCTGAAGACAAAGAAATTGAAAATACCTATGCAAGTGTGGCTAAACAGTAGAGACATCTCTT
TCAGAAGCAAAAGCTCTCTTTGTTACCTAATTTCACTTTGTGCCTTATTAGAAAGATTATTGGA
AATAATAACATAGAAAATACTATTTCCTCTAGTCAATCTAGTAATATAAAAAATAGAAAAAAAA
TAGAAAAGTTTTCCATTAGCCATAAACAATTCAACCGCTTTGTATCTTGCAGATGGCTGTATTT
TCATTTCAATTATTCCTGCAACAAACACTGAATCTTAAAAACAAAAAAAAAAAAAAAAAAAAAA
AAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001009651	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88182	(Get FASTA)	NCBI Sequence Viewer
	EDL84654	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000000955
	ENSRNOP00000000955.5
GenBank Protein	Q5M883	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001009651 ⟸ NM_001009651

- UniProtKB:

Q5M883 (UniProtKB/Swiss-Prot), A6KR35 (UniProtKB/TrEMBL), A0A8I5ZTR1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASLALNTQADPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTIDTARKPEELKDL
APGTNPPFLIYNKELKTDFIKIEEFLEKTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQ
KEANKNFEKSLLREFKRLDDYLNTPLLDEIDPDSTEERTLSRRLFLDGDQLTLADCSLLPKLNI
IKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFAHTCPEDKEIENTYASVAKQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000000955 ⟸ ENSRNOT00000000955

Ensembl Acc Id:

ENSRNOP00000082018 ⟸ ENSRNOT00000114425

Protein Domains

CLIC N-terminal GST C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5M883-F1-model_v2	AlphaFold	Q5M883	1-245	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701263

Promoter ID:

EPDNEW_R11787

Type:

initiation region

Name:

Clic2_1

Description:

chloride intracellular channel 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	20	295,307 - 295,367	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306580	AgrOrtholog
BioCyc Gene	G2FUF-5096	BioCyc
Ensembl Genes	ENSRNOG00000000728	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000000955	ENTREZGENE
	ENSRNOT00000000955.7	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.1050.10	UniProtKB/Swiss-Prot
	Glutaredoxin	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7365286	IMAGE-MGC_LOAD
InterPro	CLIC	UniProtKB/Swiss-Prot
	CLIC-2	UniProtKB/Swiss-Prot
	CLIC_N	UniProtKB/Swiss-Prot
	Glutathione-S-Trfase_C-like	UniProtKB/Swiss-Prot
	Glutathione-S-Trfase_C_sf	UniProtKB/Swiss-Prot
	Glutathione_S-Trfase	UniProtKB/Swiss-Prot
	Thioredoxin-like_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:294141	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108828	IMAGE-MGC_LOAD
NCBI Gene	294141	ENTREZGENE
PANTHER	CHLORIDE INTRACELLULAR CHANNEL PROTEIN	UniProtKB/Swiss-Prot
	CHLORIDE INTRACELLULAR CHANNEL PROTEIN 6-RELATED	UniProtKB/Swiss-Prot
Pfam	CLIC-like_N	UniProtKB/Swiss-Prot
	GST_C_2	UniProtKB/Swiss-Prot
PhenoGen	Clic2	PhenoGen
PRINTS	INTCLCHANNEL	UniProtKB/Swiss-Prot
PROSITE	GST_CTER	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000000728	RatGTEx
Superfamily-SCOP	SSF47616	UniProtKB/Swiss-Prot
	SSF52833	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZTR1	ENTREZGENE, UniProtKB/TrEMBL
	A6KR35	ENTREZGENE, UniProtKB/TrEMBL
	CLIC2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Clic2	chloride intracellular channel 2	Clic2_predicted	chloride intracellular channel 2 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Clic2_predicted	chloride intracellular channel 2 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB