Advanced Search (OLGA)

Gene: Reep4 (receptor accessory protein 4) Rattus norvegicus

Analyze

Symbol:

Reep4

Name:

receptor accessory protein 4

RGD ID:

1306561

Description:

Predicted to enable microtubule binding activity. Predicted to be involved in endoplasmic reticulum tubular network organization and mitotic nuclear membrane reassembly. Predicted to be located in endoplasmic reticulum. Predicted to be active in cytoplasmic microtubule; endoplasmic reticulum membrane; and endoplasmic reticulum tubular network. Orthologous to human REEP4 (receptor accessory protein 4); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC306014; MGC116080; receptor expression-enhancing protein 4; RGD1306561; similar to RIKEN cDNA 2700029E10

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	REEP4 (receptor accessory protein 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Reep4 (receptor accessory protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Reep4 (receptor accessory protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	REEP4 (receptor accessory protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	REEP4 (receptor accessory protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Reep4 (receptor accessory protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	REEP4 (receptor accessory protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	REEP4 (receptor accessory protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Reep4 (receptor accessory protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	USP46 (ubiquitin specific peptidase 46)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	REEP4 (receptor accessory protein 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Reep4 (receptor accessory protein 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	T19C3.4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG5539	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|PANTHER)
Drosophila melanogaster (fruit fly):	ReepA	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	reep4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	52,030,022 - 52,033,229 (+)	NCBI		GRCr8
mRatBN7.2	15	45,620,317 - 45,623,524 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	45,619,941 - 45,623,526 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	49,738,182 - 49,741,389 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	50,849,687 - 50,852,894 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	47,708,989 - 47,712,196 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	52,235,283 - 52,238,490 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	52,234,563 - 52,238,471 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	55,958,800 - 55,962,007 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	50,946,850 - 50,950,057 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	50,962,629 - 50,965,837 (+)	NCBI
Celera	15	45,298,699 - 45,301,906 (+)	NCBI		Celera
Cytogenetic Map	15	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Conotruncal Cardiac Defects (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

carbon nanotube (ISO)

cisplatin (ISO)

coumestrol (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

doxorubicin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

folic acid (ISO)

FR900359 (ISO)

gentamycin (EXP)

glafenine (EXP)

hydralazine (ISO)

hydrogen peroxide (ISO)

inulin (ISO)

leflunomide (EXP)

menadione (ISO)

methapyrilene (ISO)

ozone (EXP,ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

pirinixic acid (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

sulforaphane (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

topotecan (EXP)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell division (IEA)

endoplasmic reticulum tubular network organization (IBA)

mitotic nuclear membrane reassembly (ISO,ISS)

nuclear envelope organization (ISO,ISS)

Cellular Component

cytoplasmic microtubule (IBA)

endoplasmic reticulum (ISO,ISS)

endoplasmic reticulum membrane (IBA)

endoplasmic reticulum tubular network (IBA)

Molecular Function

microtubule binding (IBA,ISS)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15489334	PMID:23911198

Genomics

Comparative Map Data

Reep4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	52,030,022 - 52,033,229 (+)	NCBI		GRCr8
mRatBN7.2	15	45,620,317 - 45,623,524 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	45,619,941 - 45,623,526 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	49,738,182 - 49,741,389 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	50,849,687 - 50,852,894 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	47,708,989 - 47,712,196 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	52,235,283 - 52,238,490 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	52,234,563 - 52,238,471 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	55,958,800 - 55,962,007 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	50,946,850 - 50,950,057 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	50,962,629 - 50,965,837 (+)	NCBI
Celera	15	45,298,699 - 45,301,906 (+)	NCBI		Celera
Cytogenetic Map	15	p11	NCBI

REEP4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	22,138,020 - 22,141,907 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	22,138,020 - 22,141,951 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	21,995,533 - 21,999,420 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	22,051,478 - 22,055,393 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	22,051,477 - 22,055,393	NCBI
Celera	8	20,957,454 - 20,961,369 (-)	NCBI		Celera
Cytogenetic Map	8	p21.3	NCBI
HuRef	8	20,537,806 - 20,541,721 (-)	NCBI		HuRef
CHM1_1	8	22,197,215 - 22,201,111 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	22,411,968 - 22,415,855 (-)	NCBI		T2T-CHM13v2.0

Reep4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	70,782,666 - 70,786,375 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	70,782,691 - 70,786,373 (+)	Ensembl		GRCm39 Ensembl
GRCm38	14	70,545,223 - 70,548,935 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	70,545,251 - 70,548,933 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	70,945,430 - 70,948,739 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	69,280,703 - 69,284,012 (+)	NCBI		MGSCv36	mm8
Celera	14	68,087,324 - 68,090,655 (+)	NCBI		Celera
Cytogenetic Map	14	D2	NCBI
cM Map	14	36.32	NCBI

Reep4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	45,627,750 - 45,631,481 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955403	45,627,750 - 45,631,481 (-)	NCBI	ChiLan1.0	ChiLan1.0

REEP4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	40,639,836 - 40,644,281 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	16,365,025 - 16,368,966 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	21,382,943 - 21,386,871 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	18,322,302 - 18,326,232 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	18,322,302 - 18,326,212 (-)	Ensembl	panpan1.1		panPan2

REEP4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	25	35,109,210 - 35,113,152 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	25	35,109,236 - 35,117,048 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	25	35,698,825 - 35,702,736 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	25	35,320,600 - 35,324,510 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	25	35,320,595 - 35,324,527 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	25	35,266,059 - 35,269,967 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	35,120,613 - 35,124,524 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	35,276,084 - 35,279,995 (+)	NCBI		UU_Cfam_GSD_1.0

Reep4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404943	12,608,034 - 12,611,848 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936555	5,958,352 - 5,962,524 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936555	5,958,586 - 5,962,472 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

REEP4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	6,411,513 - 6,415,590 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	6,411,510 - 6,415,612 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	6,848,705 - 6,852,809 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

REEP4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	20,207,609 - 20,211,509 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	20,207,592 - 20,211,417 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666052	22,024,572 - 22,028,474 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Reep4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624758	17,720,700 - 17,724,702 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624758	17,720,917 - 17,724,741 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Reep4
3 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	69
Count of miRNA genes:	51
Interacting mature miRNAs:	61
Transcripts:	ENSRNOT00000015169
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331729	Rf42	Renal function QTL 42	3.071		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	15	17362897	73690657	Rat
1582227	Gluco30	Glucose level QTL 30	3.6	0.0003	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	15	28030665	82262678	Rat
1582228	Epfw3	Epididymal fat weight QTL 3	4.1	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	22806240	98288169	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	22806240	98288169	Rat
2293686	Bmd36	Bone mineral density QTL 36	7.4	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	15	33611058	71477291	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	12496141	65205939	Rat
2298549	Neuinf12	Neuroinflammation QTL 12	3.5		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	15	1	55302115	Rat
2293691	Bmd37	Bone mineral density QTL 37	6.6	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	15	33611058	71477291	Rat
2293688	Bss29	Bone structure and strength QTL 29	5.31	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	15	11111142	56111142	Rat
1582214	Stl21	Serum triglyceride level QTL 21	3.1	0.022	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	15	28030665	82262678	Rat
631273	Lecl2	Lens clarity QTL 2		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	15	10596089	55596089	Rat
1300144	Rf23	Renal function QTL 23	3.61		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	15	40631268	98288169	Rat
2300167	Bmd63	Bone mineral density QTL 63	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2266368	46921453	Rat
152025253	Hrtrt24	Heart rate QTL 24	3.82		heart pumping trait (VT:2000009)		15	27885774	86257085	Rat
10054130	Srcrt8	Stress Responsive Cort QTL 8	2.18	0.0085	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	22117933	67117933	Rat
2300173	Bmd62	Bone mineral density QTL 62	12.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
2324620	Coatc3	Coat color QTL 3			coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	15	19856566	46187442	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	16725528	80672115	Rat
1582251	Gluco24	Glucose level QTL 24	3.2	0.0008	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	15	5530756	50530756	Rat
1598828	Glom14	Glomerulus QTL 14	2.5		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	15	34054139	79054139	Rat
1582242	Gluco28	Glucose level QTL 28	3.3	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	15	28030665	82262678	Rat
2306968	Anxrr23	Anxiety related response QTL 23	4.83		reflex trait (VT:0001961)	amplitude of the acoustic startle response (CMO:0001520)	15	40631268	46187442	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	22806240	98288169	Rat
1582244	Bw79	Body weight QTL 79	4	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat
7411725	Strs7	Sensitivity to stroke QTL 7	3.8		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	15	40289901	49308583	Rat

Markers in Region

D15Got109

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	15	52,028,516 - 52,028,684 (+)	Marker Load Pipeline
mRatBN7.2	15	45,618,811 - 45,618,979 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	52,233,778 - 52,233,945	NCBI	Rnor6.0
Rnor_5.0	15	55,957,295 - 55,957,462	UniSTS	Rnor5.0
RGSC_v3.4	15	50,945,345 - 50,945,512	UniSTS	RGSC3.4
Celera	15	45,297,194 - 45,297,361	UniSTS
Cytogenetic Map	15	p11	UniSTS

RH129078

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	45,623,294 - 45,623,478 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	52,238,261 - 52,238,444	NCBI	Rnor6.0
Rnor_5.0	15	55,961,778 - 55,961,961	UniSTS	Rnor5.0
RGSC_v3.4	15	50,949,828 - 50,950,011	UniSTS	RGSC3.4
Celera	15	45,301,677 - 45,301,860	UniSTS
Cytogenetic Map	15	p11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025279	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC097957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473951	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015169 ⟹ ENSRNOP00000015169

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	45,619,941 - 45,623,526 (+)	Ensembl
Rnor_6.0 Ensembl	15	52,234,563 - 52,238,471 (+)	Ensembl

RefSeq Acc Id:

NM_001025279 ⟹ NP_001020450

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	52,030,022 - 52,033,229 (+)	NCBI
mRatBN7.2	15	45,620,317 - 45,623,524 (+)	NCBI
Rnor_6.0	15	52,235,283 - 52,238,490 (+)	NCBI
Rnor_5.0	15	55,958,800 - 55,962,007 (+)	NCBI
RGSC_v3.4	15	50,946,850 - 50,950,057 (+)	RGD
Celera	15	45,298,699 - 45,301,906 (+)	RGD

Sequence:

show sequence

ATCCCTTAGACTGTCAGGATGGTGTCTTGGATGATCTGTCGCCTGGTGGTGCTAATATTTGGCA
TGCTATATCCTGCATATGCTTCCTACAAGGCTGTGAAGAGCAAGAACATCCGAGAATATGTCCG
GTGGATGATGTATTGGATTGTCTTTGCAATCTTCATGGCAGCGGAAACCTTCACAGACATCTTC
ATTTCCTGGTTCCCGTTTTATTATGAGATCAAGATGGCCTTCGTGCTGTGGCTGCTGTCACCTT
ACACCAAGGGGGCCAGCCTGCTTTACAGAAAGTTTGTCCACCCGTCCCTATCCCGCCACGAGAA
GGAGATCGACGCATGCATTGTGCAGGCAAAGGAGCGCAGCTACGAAACCATGCTCAGTTTCGGG
AAGCGGAGCCTCAACATGGCTGCCTCTGCCGCTGTGCAGGCTGCTACCAAGAGTCAAGGTGCCC
TAGCTGGAAGGCTGAGGAGCTTCTCTATGCAAGATCTGCGCTCTATCCCTGACACCTCTGCCCC
CACCTACCAAGATCCCCTCTACCTGGAAGACCAGGCCCCCCGGCGGAGACCCCCTATCGGATAC
CGGCCAGGCGGCCTGCAAGACAGTGACACAGAGGACGAGTGTTGGTCAGACAATGAGATAGCCC
CCCAGCCACCTGTTCGGCCCCGAGAGAAGCCTCTGAGTCGCAGCCAGAGCCTCCGTGTGGTCAA
GAGAAAGCCATTAGTTCGAGAGGGCACCTCACGCTCCTTGAAGGTCCGAACCCGGAAAAAGACC
ATTCCCTCTGACCTGGACAGCTAGAATCTGCAGATGCAGGCCACCTTACCTCTGGAGCCAGCAG
GGGACCTTTCTCTGCTCCTTCTGGCTTCTGCCTAAGGCTGTGCCTAAGGGGCACATGGTGTGCT
ACCCTCCAGGGGCTACACCCACAGTATACCAAAGCAGGCCAGGCCCAGGGTTATTTATTGCCTT
CCTCTGCCTTTTACTTTCCCAGACAGGGAACCAGAGCCCCACCAGTCCCTAAAGACAAAACCAA
AAGTCCAACCAGCTGTGTTCATTCCTTCTTGTCCTCCAAAATACTTGACAGCCTTTTCCAAGGC
CTGGTGTGTGTCCATGTGTGTGTGTGCGCAGGTGTGTCCTAGCTGAGTGTTTTGTGTTGGTGAG
TGAGGTCAGGCTTGTGAATATTTTTATAAATAAATACCAGTGTTTGGCCTCTCCAAAAAAAAAA
AAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001020450	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH97957	(Get FASTA)	NCBI Sequence Viewer
	EDM02226	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015169.4
	ENSRNOP00055021255
	ENSRNOP00060015289
	ENSRNOP00065023769
GenBank Protein	Q4QQW1	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001020450 ⟸ NM_001025279

- UniProtKB:

Q4QQW1 (UniProtKB/Swiss-Prot), A6HTL3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVSWMICRLVVLIFGMLYPAYASYKAVKSKNIREYVRWMMYWIVFAIFMAAETFTDIFISWFPF
YYEIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDACIVQAKERSYETMLSFGKRSLNM
AASAAVQAATKSQGALAGRLRSFSMQDLRSIPDTSAPTYQDPLYLEDQAPRRRPPIGYRPGGLQ
DSDTEDECWSDNEIAPQPPVRPREKPLSRSQSLRVVKRKPLVREGTSRSLKVRTRKKTIPSDLD
S

hide sequence

Ensembl Acc Id:

ENSRNOP00000015169 ⟸ ENSRNOT00000015169

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4QQW1-F1-model_v2	AlphaFold	Q4QQW1	1-257	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699814

Promoter ID:

EPDNEW_R10336

Type:

initiation region

Name:

Reep4_1

Description:

receptor accessory protein 4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	15	52,234,881 - 52,234,941	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306561	AgrOrtholog
BioCyc Gene	G2FUF-13211	BioCyc
Ensembl Genes	ENSRNOG00000011373	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055015296	UniProtKB/Swiss-Prot
	ENSRNOG00060011504	UniProtKB/Swiss-Prot
	ENSRNOG00065017879	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000015169.7	UniProtKB/Swiss-Prot
	ENSRNOT00055026120	UniProtKB/Swiss-Prot
	ENSRNOT00060019473	UniProtKB/Swiss-Prot
	ENSRNOT00065029924	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7462731	IMAGE-MGC_LOAD
InterPro	TB2_DP1_HVA22	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:306014	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:116080	IMAGE-MGC_LOAD
NCBI Gene	306014	ENTREZGENE
PANTHER	HVA22-LIKE PROTEINS	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
	RECEPTOR EXPRESSION-ENHANCING PROTEIN 4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	TB2_DP1_HVA22	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Reep4	PhenoGen
RatGTEx	ENSRNOG00000011373	RatGTEx
	ENSRNOG00055015296	RatGTEx
	ENSRNOG00060011504	RatGTEx
	ENSRNOG00065017879	RatGTEx
UniProt	A6HTL3	ENTREZGENE, UniProtKB/TrEMBL
	Q4QQW1	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Reep4	receptor accessory protein 4	RGD1306561	similar to RIKEN cDNA 2700029E10	Symbol and Name updated	1299863	APPROVED
2005-12-06	RGD1306561	similar to RIKEN cDNA 2700029E10	RGD1306561_predicted	similar to RIKEN cDNA 2700029E10 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1306561_predicted	similar to RIKEN cDNA 2700029E10 (predicted)	LOC306014_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC306014_predicted	similar to RIKEN cDNA 2700029E10 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar