Dhcr24 (24-dehydrocholesterol reductase)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Dhcr24 (24-dehydrocholesterol reductase) Rattus norvegicus

Analyze

Symbol:

Dhcr24

Name:

24-dehydrocholesterol reductase

RGD ID:

1306529

Description:

Predicted to enable enzyme binding activity; oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor; and peptide antigen binding activity. Involved in several processes, including Ras protein signal transduction; negative regulation of cell population proliferation; and steroid metabolic process. Predicted to be located in endoplasmic reticulum and nucleus. Predicted to be active in cytoplasm. Human ortholog(s) of this gene implicated in lipid metabolism disorder. Orthologous to human DHCR24 (24-dehydrocholesterol reductase); PARTICIPATES IN alendronate pharmacodynamics pathway; cholesterol biosynthetic pathway; cholesterol ester storage disease pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

3-beta-hydroxysterol delta-24-reductase; delta(24)-sterol reductase; LOC298298; seladin-1

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DHCR24 (24-dehydrocholesterol reductase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Dhcr24 (24-dehydrocholesterol reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dhcr24 (24-dehydrocholesterol reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DHCR24 (24-dehydrocholesterol reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DHCR24 (24-dehydrocholesterol reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dhcr24 (24-dehydrocholesterol reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DHCR24 (24-dehydrocholesterol reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DHCR24 (24-dehydrocholesterol reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dhcr24 (24-dehydrocholesterol reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	KLK3 (kallikrein related peptidase 3)	HGNC	OMA
Homo sapiens (human):	KLK2 (kallikrein related peptidase 2)	HGNC	OMA
Homo sapiens (human):	KLK1 (kallikrein 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	DHCR24 (24-dehydrocholesterol reductase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Dhcr24 (24-dehydrocholesterol reductase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dhcr24 (24-dehydrocholesterol reductase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F52H2.6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	dhcr24	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	121,344,552 - 121,371,124 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	121,344,575 - 121,371,137 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	123,957,501 - 123,981,506 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	125,680,549 - 125,704,554 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	125,731,821 - 125,755,826 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	126,164,708 - 126,188,926 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	126,164,674 - 126,191,206 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	130,011,465 - 130,034,921 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	127,637,438 - 127,662,621 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	127,592,941 - 127,670,118 (+)	NCBI
Celera	5	120,093,779 - 120,117,321 (+)	NCBI		Celera
Cytogenetic Map	5	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Alzheimer's disease (ISO)

autism spectrum disorder (ISO)

COVID-19 (ISO)

Desmosterolosis (ISO)

genetic disease (ISO)

Hydrops Fetalis (ISO)

lipid metabolism disorder (ISO)

Q fever (ISO)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

(S)-nicotine (ISO)

1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,3-bis(4-hydroxyphenyl)propionitrile (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime (ISO)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (ISO)

acetamide (EXP)

acrolein (ISO)

acrylamide (ISO)

afimoxifene (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (EXP,ISO)

alpha-pinene (ISO)

amiodarone (EXP)

amphetamine (EXP)

Archazolid B (ISO)

atrazine (ISO)

benzalkonium chloride (ISO)

benzatropine (ISO)

benzbromarone (EXP)

benzene (EXP)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

bleomycin A5 (ISO)

butanal (ISO)

cadmium sulfide (ISO)

caffeine (EXP)

calcitriol (ISO)

celecoxib (ISO)

cerium trichloride (ISO)

cetrorelix (ISO)

cholesterol (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

clobetasol (ISO)

clofibrate (EXP)

clozapine (ISO)

cobalt dichloride (EXP,ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

curcumin (EXP,ISO)

cyclosporin A (ISO)

cytarabine (ISO)

dehydroepiandrosterone (ISO)

desmosterol (ISO)

desogestrel (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

dibutyl phthalate (EXP)

dichloromethane (ISO)

diclofenac (ISO)

dinophysistoxin 1 (ISO)

dioxygen (ISO)

diuron (ISO)

dutasteride (ISO)

elemental selenium (ISO)

endosulfan (EXP)

ethanol (ISO)

ethyl methanesulfonate (ISO)

fenthion (ISO)

fluoranthene (ISO)

formaldehyde (ISO)

furan (EXP)

gallic acid (ISO)

genistein (ISO)

gentamycin (EXP)

glafenine (EXP)

glycidyl methacrylate (ISO)

gold atom (ISO)

gold(0) (ISO)

indometacin (ISO)

isoprenaline (ISO)

isotretinoin (ISO)

ivermectin (ISO)

L-ethionine (EXP)

leflunomide (EXP)

lucanthone (ISO)

methamphetamine (EXP)

methidathion (ISO)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

methylmercury(1+) (EXP)

methylseleninic acid (ISO)

miconazole (ISO)

mono(2-ethylhexyl) phthalate (ISO)

morphine (ISO)

N,N-diethyl-m-toluamide (EXP)

nebivolol (ISO)

nickel dichloride (EXP,ISO)

nicotine (ISO)

nitrofen (EXP)

ochratoxin A (EXP)

omeprazole (EXP)

ozone (ISO)

paclitaxel (ISO)

paracetamol (ISO)

paraquat (ISO)

pentanal (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

permethrin (EXP,ISO)

phenobarbital (ISO)

pirinixic acid (EXP,ISO)

potassium dichromate (ISO)

Pyridostigmine bromide (EXP)

quercetin (ISO)

raloxifene (ISO)

rifampicin (ISO)

rotenone (EXP)

Se-methyl-L-selenocysteine (EXP)

Se-methylselenocysteine (EXP)

selenium atom (ISO)

silicon dioxide (ISO)

simvastatin (EXP,ISO)

sodium arsenite (ISO)

succimer (ISO)

sulforaphane (ISO)

sulindac sulfide (ISO)

sunitinib (ISO)

T-2 toxin (ISO)

tacrolimus hydrate (ISO)

testosterone enanthate (ISO)

tetrachloromethane (EXP,ISO)

thapsigargin (EXP,ISO)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

tolcapone (EXP)

trichloroethene (EXP)

trimellitic anhydride (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vitexin (ISO)

vorinostat (ISO)

Yessotoxin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

amyloid precursor protein catabolic process (ISO)

cholesterol biosynthetic process (ISO,ISS)

cholesterol biosynthetic process via desmosterol (ISO)

cholesterol metabolic process (ISO)

male genitalia development (ISO)

membrane organization (ISO)

negative regulation of apoptotic process (ISO,ISS)

negative regulation of cell population proliferation (IMP)

plasminogen activation (ISO)

protein localization (ISO)

Ras protein signal transduction (IMP)

response to hormone (IEP)

response to oxidative stress (ISO,ISS)

skin development (ISO,ISS)

steroid metabolic process (IBA,IMP)

sterol metabolic process (ISO)

tissue development (ISO,ISS)

Cellular Component

cytoplasm (IBA)

endoplasmic reticulum (ISO,ISS)

endoplasmic reticulum membrane (IEA)

Golgi membrane (IEA)

nucleus (ISO,ISS)

Molecular Function

delta24(24-1) sterol reductase activity (IBA,ISO)

delta24-sterol reductase activity (IC,ISO)

enzyme binding (ISO,ISS)

FAD binding (IEA)

oxidoreductase activity (NAS)

oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor (ISO)

peptide antigen binding (ISO,ISS)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

alendronate pharmacodynamics pathway (ISO)

cholesterol biosynthetic pathway (ISO)

cholesterol ester storage disease pathway (ISO)

congenital hemidysplasia with ichthyosiform erythroderma and limb defects pathway (ISO)

desmosterolosis pathway (ISO)

hypercholesterolemia pathway (ISO)

ibandronate pharmacodynamics pathway (ISO)

mevalonic aciduria pathway (ISO)

nitrogenous bisphosphonate pharmacodynamics pathway (ISO)

pamidronate pharmacodynamics pathway (ISO)

risedronate pharmacodynamics pathway (ISO)

Smith-Lemli-Opitz Syndrome pathway (ISO)

statin pharmacodynamics pathway (ISO)

steroid biosynthetic pathway (IEA)

Wolman disease pathway (ISO)

X-linked dominant chondrodysplasia punctata 2 pathway (ISO)

zoledronate pharmacodynamics pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Seladin-1 expression in rat adrenal gland: effect of adrenocorticotropic hormone treatment.	Battista MC, etal., J Endocrinol. 2007 Jan;192(1):53-66.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Disorders of cholesterol biosynthesis: prototypic metabolic malformation syndromes.	Herman GE Hum Mol Genet. 2003 Apr 1;12 Spec No 1:R75-88.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	From integrative signalling to metabolic disorders.	Otis M, etal., J Steroid Biochem Mol Biol. 2008 Apr;109(3-5):224-9. Epub 2008 Mar 8.
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Comprehensive gene review and curation	RGD comprehensive gene curation
14.	Defects of cholesterol biosynthesis.	Waterham HR FEBS Lett. 2006 Oct 9;580(23):5442-9. Epub 2006 Jul 20.
15.	Mutations in the 3beta-hydroxysterol Delta24-reductase gene cause desmosterolosis, an autosomal recessive disorder of cholesterol biosynthesis.	Waterham HR, etal., Am J Hum Genet. 2001 Oct;69(4):685-94. Epub 2001 Aug 22.
16.	Regulation of cellular response to oncogenic and oxidative stress by Seladin-1.	Wu C, etal., Nature. 2004 Dec 2;432(7017):640-5.

Additional References at PubMed

PMID:11007892	PMID:12457401	PMID:14684813	PMID:15688385	PMID:16321981	PMID:16407971	PMID:16410790	PMID:16513830	PMID:19520779	PMID:19946888	PMID:24842139	PMID:24916565
PMID:33450132	PMID:34338991

Genomics

Comparative Map Data

Dhcr24
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	121,344,552 - 121,371,124 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	121,344,575 - 121,371,137 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	123,957,501 - 123,981,506 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	125,680,549 - 125,704,554 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	125,731,821 - 125,755,826 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	126,164,708 - 126,188,926 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	126,164,674 - 126,191,206 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	130,011,465 - 130,034,921 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	127,637,438 - 127,662,621 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	127,592,941 - 127,670,118 (+)	NCBI
Celera	5	120,093,779 - 120,117,321 (+)	NCBI		Celera
Cytogenetic Map	5	q34	NCBI

DHCR24
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	54,849,627 - 54,887,195 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	54,849,627 - 54,887,195 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	55,315,300 - 55,352,868 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	55,087,888 - 55,125,509 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	55,027,320 - 55,064,926	NCBI
Celera	1	53,602,965 - 53,640,513 (-)	NCBI		Celera
Cytogenetic Map	1	p32.3	NCBI
HuRef	1	53,429,205 - 53,466,807 (-)	NCBI		HuRef
CHM1_1	1	55,431,045 - 55,468,571 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	54,729,905 - 54,767,373 (-)	NCBI		T2T-CHM13v2.0

Dhcr24
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	106,418,279 - 106,446,310 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	106,418,235 - 106,446,310 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	106,561,038 - 106,589,113 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	106,561,038 - 106,589,113 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	106,233,643 - 106,261,718 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	106,059,082 - 106,084,718 (+)	NCBI		MGSCv36	mm8
Celera	4	104,921,880 - 104,950,010 (+)	NCBI		Celera
Cytogenetic Map	4	C7	NCBI
cM Map	4	49.67	NCBI

Dhcr24
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955464	4,533,928 - 4,558,133 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955464	4,533,928 - 4,557,893 (+)	NCBI	ChiLan1.0	ChiLan1.0

DHCR24
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	1	171,087,542 - 171,125,109 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	54,126,170 - 54,163,713 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	55,714,693 - 55,752,075 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	55,714,693 - 55,754,698 (-)	Ensembl	panpan1.1		panPan2

DHCR24
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	54,294,055 - 54,324,389 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	54,294,046 - 54,321,921 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	54,362,817 - 54,393,132 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	54,481,753 - 54,512,044 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	54,481,728 - 54,545,270 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	54,478,780 - 54,509,047 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	54,368,590 - 54,398,883 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	54,757,309 - 54,787,616 (+)	NCBI		UU_Cfam_GSD_1.0

Dhcr24
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	68,968,931 - 68,992,733 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936522	6,423,561 - 6,444,814 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936522	6,423,561 - 6,447,363 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DHCR24
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	157,483,783 - 157,519,061 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	157,483,794 - 157,519,060 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	145,547,688 - 145,582,947 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DHCR24
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	78,052,565 - 78,088,918 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	78,052,607 - 78,086,303 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	39,196,929 - 39,233,564 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dhcr24
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624862	4,995,720 - 5,020,850 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624862	4,995,836 - 5,022,395 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Dhcr24
93 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	100
Count of miRNA genes:	79
Interacting mature miRNAs:	85
Transcripts:	ENSRNOT00000009402
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	66174080	124160948	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
1298070	Scl18	Serum cholesterol level QTL 18	3.7		blood LDL cholesterol amount (VT:0000181)	calculated plasma low density lipoprotein cholesterol level (CMO:0001245)	5	79584860	124584860	Rat
1598846	Bp293	Blood pressure QTL 293	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	79584860	124584860	Rat
1598859	Cm66	Cardiac mass QTL 66	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	79584860	124584860	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1298086	Bp156	Blood pressure QTL 156			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	84132602	129132602	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	87468046	132468046	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	87765973	132765973	Rat
1358889	Bp261	Blood pressure QTL 261	2.86		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	90067849	128034027	Rat
1358909	Kidm25	Kidney mass QTL 25	1.87		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	90067849	128034027	Rat
631527	Tls1	T-lymphoma susceptibility QTL 1	0	0.001	thymus integrity trait (VT:0010555)	post-insult time to onset of T-cell lymphoma (CMO:0001907)	5	90450144	135450144	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	94858972	143070159	Rat
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	97570330	136479578	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
7794739	Bp372	Blood pressure QTL 372		0.0058	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	117913688	125222967	Rat
1582230	Bw78	Body weight QTL 78	3.2	0.0016	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	119085612	128034027	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	120740824	143608494	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat

Markers in Region

RH129237

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	121,370,904 - 121,371,123 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	126,190,978 - 126,191,196	NCBI	Rnor6.0
Rnor_5.0	5	130,036,973 - 130,037,191	UniSTS	Rnor5.0
RGSC_v3.4	5	127,664,673 - 127,664,891	UniSTS	RGSC3.4
Celera	5	120,119,373 - 120,119,591	UniSTS
RH 3.4 Map	5	806.2	UniSTS
Cytogenetic Map	5	q34	UniSTS

RH128821

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	121,370,912 - 121,371,124 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	126,190,986 - 126,191,197	NCBI	Rnor6.0
Rnor_5.0	5	130,036,981 - 130,037,192	UniSTS	Rnor5.0
RGSC_v3.4	5	127,664,681 - 127,664,892	UniSTS	RGSC3.4
Celera	5	120,119,381 - 120,119,592	UniSTS
RH 3.4 Map	5	804.7	UniSTS
Cytogenetic Map	5	q34	UniSTS

RH129232

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	121,370,904 - 121,371,121 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	126,190,978 - 126,191,194	NCBI	Rnor6.0
Rnor_5.0	5	130,036,973 - 130,037,189	UniSTS	Rnor5.0
RGSC_v3.4	5	127,664,673 - 127,664,889	UniSTS	RGSC3.4
Celera	5	120,119,373 - 120,119,589	UniSTS
RH 3.4 Map	5	804.5	UniSTS
Cytogenetic Map	5	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	26	52	41	6	41	1	4	74	35	38	9	1
Low		17	5		13		7	7			3	2	7
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001080148	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC117905	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY310319	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY921220	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MW396187	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000009402 ⟹ ENSRNOP00000009402

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	121,344,575 - 121,371,137 (+)	Ensembl
Rnor_6.0 Ensembl	5	126,164,674 - 126,191,206 (+)	Ensembl

RefSeq Acc Id:

NM_001080148 ⟹ NP_001073617

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	121,344,552 - 121,371,124 (+)	NCBI
Rnor_6.0	5	126,164,708 - 126,188,926 (+)	NCBI
Rnor_5.0	5	130,011,465 - 130,034,921 (+)	NCBI
RGSC_v3.4	5	127,637,438 - 127,662,621 (+)	RGD
Celera	5	120,093,779 - 120,117,321 (+)	RGD

Sequence:

show sequence

ATGGAGCCCGCCGTGTCGCTGGCCGTGTGCGCGCTGCTCTTTCTGCTCTGGGTGCGAGTGAAGG
GGTTGGAGTTCGTTCTCATCCACCAACGCTGGGTGTTTGTGTGCCTCTTCCTGCTACCGCTCTC
CCTCATCTTCGACATCTACTACTACGTGCGCGCCTGGGTGGTGTTCAAGCTGAGCAGTGCGCCG
CGCTTGCACGAGCAGCGCGTGCAGGACATCCAGAAACAGGTACGGGAGTGGAAGGAGCAGGGCA
GTAAGACCTTCATGTGCACGGGGCGTCCTGGATGGCTCACTGTCTCACTGCGGGTTGGGAAGTA
CAGGAAGACGCATAAGAACATCATGATCAACCTGATGGACATTCTGGAGGTGGACACCAAGAAA
CAGATTGTGCGAGTGGAGCCCTTGGTGTCTATGGGTCAGGTGACAGCTTTGCTGAACTCCATTG
GCTGGACTCTGCCTGTGTTGCCTGAACTCGATGACCTCACAGTGGGGGGCCTGATCATGGGCGC
CGGCATCGAGTCATCGTCCCACAAGTATGGCCTGTTCCAACACATCTGTACGGCCTACGAGCTA
ATCCTGGCAGATGGCAGCTTTGTGCGCTGCACACCGTCTGAAAACTCAGACCTGTTCTATGCCG
TACCCTGGTCCTGTGGGACCCTGGGCTTCCTGGTGGCTGCTGAGATCCGCATCATCCCTGCCAA
GAAGTATGTCAAGCTGCGGTTTGAGCCAGTGCGGGGCCTGGAGGCCATCTGTGAGAAATTCACC
CATGAGTCCCAGCGGCTGGAGAACCACTTCGTGGAAGGGTTGCTGTATTCCTTGGATGAGGCTG
TCATCATGACAGGGGTCATGACGGATGATGTAGAGCCCAGCAAGCTGAATAGCATTGGCAGTTA
CTACAAGCCGTGGTTCTTCAAGCATGTGGAGAACTACCTGAAGACAAACCGAGAGGGCCTTGAA
TACATTCCCCTGAGGCACTACTACCACCGCCACACGCGCAGCATCTTCTGGGAGCTCCAGGACA
TCATCCCTTTTGGCAACAACCCCATCTTCCGCTACCTCTTTGGCTGGATGGTGCCTCCCAAGAT
CTCCCTCCTGAAGCTGACCCAGGGCGAGACTCTGCGTAAACTGTATGAACAGCATCATGTGGTA
CAGGACATGCTGGTACCCATGAAATGCCTGTCTCAGGCCCTGCATACCTTCCAAAATGACATCC
ACGTCTACCCCATCTGGCTGTGCCCGTTCATCCTGCCCAGCCAGCCAGGACTTGTGCATCCCAA
GGGAGATGAGGCTGAACTCTACGTGGACATCGGGGCATATGGGGAGCCACGGGTGAAGCACTTC
GAGGCCAGGTCCTGCATGAGGCAGCTGGAGAAGTTTGTGCGGAGCGTGCACGGGTTCCAGATGT
TATACGCCGATTGCTATATGAACCGGGAGGAATTCTGGGAGATGTTCGATGGCTCCTTGTACCA
CAAGCTGCGCAAGCAGCTTGGCTGCCAGGACGCCTTCCCTGAGGTGTATGACAAGATCTGCAAG
GCGGCAAGGCACTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001073617	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAS66628	(Get FASTA)	NCBI Sequence Viewer
	AAX29968	(Get FASTA)	NCBI Sequence Viewer
	Q5BQE6	(Get FASTA)	NCBI Sequence Viewer
	QST78217	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001073617 ⟸ NM_001080148
- Peptide Label:	precursor
- UniProtKB:	Q5BQE6 (UniProtKB/Swiss-Prot), A6JYN2 (UniProtKB/TrEMBL), A1KXK4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEPAVSLAVCALLFLLWVRVKGLEFVLIHQRWVFVCLFLLPLSLIFDIYYYVRAWVVFKLSSAP RLHEQRVQDIQKQVREWKEQGSKTFMCTGRPGWLTVSLRVGKYRKTHKNIMINLMDILEVDTKK QIVRVEPLVSMGQVTALLNSIGWTLPVLPELDDLTVGGLIMGAGIESSSHKYGLFQHICTAYEL ILADGSFVRCTPSENSDLFYAVPWSCGTLGFLVAAEIRIIPAKKYVKLRFEPVRGLEAICEKFT HESQRLENHFVEGLLYSLDEAVIMTGVMTDDVEPSKLNSIGSYYKPWFFKHVENYLKTNREGLE YIPLRHYYHRHTRSIFWELQDIIPFGNNPIFRYLFGWMVPPKISLLKLTQGETLRKLYEQHHVV QDMLVPMKCLSQALHTFQNDIHVYPIWLCPFILPSQPGLVHPKGDEAELYVDIGAYGEPRVKHF EARSCMRQLEKFVRSVHGFQMLYADCYMNREEFWEMFDGSLYHKLRKQLGCQDAFPEVYDKICK AARH hide sequence

RefSeq Acc Id:

ENSRNOP00000009402 ⟸ ENSRNOT00000009402

Protein Domains

FAD-binding PCMH-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5BQE6-F1-model_v2	AlphaFold	Q5BQE6	1-516	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306529	AgrOrtholog
BioCyc Gene	G2FUF-40450	BioCyc
BioCyc Pathway	PWY66-4 [cholesterol biosynthesis III (via desmosterol)]	BioCyc
Ensembl Genes	ENSRNOG00000006787	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000009402	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000009402	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.465.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Diminuto-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FAD-bd_PCMH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FAD-bd_PCMH-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FAD-bd_PCMH_sub2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Oxid_FAD_bind_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:298298	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	298298	ENTREZGENE
PANTHER	DELTA(24)-STEROL REDUCTASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10801	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	FAD_binding_4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Dhcr24	PhenoGen
PROSITE	FAD_PCMH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF56176	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8A1UCK8_RAT	UniProtKB/TrEMBL
	A1KXK4	ENTREZGENE, UniProtKB/TrEMBL
	A6JYN2	ENTREZGENE, UniProtKB/TrEMBL
	DHC24_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Dhcr24	24-dehydrocholesterol reductase	Dhcr24_predicted	24-dehydrocholesterol reductase (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Dhcr24_predicted	24-dehydrocholesterol reductase (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)