Mnda (myeloid cell nuclear differentiation antigen)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Mnda (myeloid cell nuclear differentiation antigen) Rattus norvegicus

Analyze

Symbol:

Mnda

Name:

myeloid cell nuclear differentiation antigen

RGD ID:

1306089

Description:

Predicted to enable double-stranded DNA binding activity and transcription coregulator activity. Predicted to be involved in several processes, including activation of immune response; cellular response to cytokine stimulus; and negative regulation of B cell proliferation. Predicted to act upstream of or within inner ear development; positive regulation of osteoblast differentiation; and regulation of transcription by RNA polymerase II. Predicted to be located in cytosol and nucleus. Predicted to be active in nucleolus. Orthologous to several human genes including PYHIN1 (pyrin and HIN domain family member 1); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 17beta-estradiol 3-benzoate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Ifi204; interferon activated gene 204; LOC304988; rHin-3

RGD Orthologs

Human

Mouse

Bonobo

Dog

Green Monkey

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	13	86,017,888 - 86,035,556 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	86,017,892 - 86,034,201 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	88,525,833 - 88,543,479 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	13	89,926,105 - 89,943,751 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	13	87,110,842 - 87,128,488 (-)	NCBI	Rnor_WKY
Rnor_6.0	13	92,073,664 - 92,091,335 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	92,073,668 - 92,089,980 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	96,545,815 - 96,606,181 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	89,752,997 - 89,770,167 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	89,941,881 - 89,959,051 (-)	NCBI
Celera	13	85,620,545 - 85,638,000 (-)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autoimmune interstitial lung, joint, and kidney disease (ISO)

Experimental Liver Cirrhosis (ISO)

gastrointestinal stromal tumor (ISO)

genetic disease (ISO)

parathyroid carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrobenzenesulfonic acid (ISO)

2-amino-2-deoxy-D-glucopyranose (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (EXP,ISO)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

aldehydo-D-glucosamine (ISO)

all-trans-retinoic acid (ISO)

amphetamine (EXP)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

beta-D-glucosamine (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

buta-1,3-diene (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

chloroprene (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

clofibrate (ISO)

copper atom (EXP)

copper(0) (EXP)

cyclophosphamide (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

dichlorine (ISO)

diclofenac (ISO)

diethylstilbestrol (ISO)

dioxygen (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

fluoranthene (ISO)

folic acid (ISO)

furan (EXP)

gentamycin (EXP)

Indeno[1,2,3-cd]pyrene (ISO)

indole-3-methanol (EXP)

lidocaine (EXP)

lipopolysaccharide (ISO)

manganese(II) chloride (EXP)

metam (ISO)

N-nitrosodimethylamine (EXP)

nickel atom (ISO)

nitrofen (EXP)

nonanoic acid (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

pentachlorophenol (ISO)

perfluorooctanoic acid (ISO)

pirinixic acid (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

serpentine asbestos (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

succimer (ISO)

sulforaphane (ISO)

tamoxifen (ISO)

testosterone (EXP)

tetrachloromethane (ISO)

tetraphene (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

tremolite asbestos (ISO)

trichloroethene (EXP)

trovafloxacin (ISO)

valproic acid (ISO)

zidovudine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

activation of innate immune response (IBA)

B cell receptor signaling pathway (ISO)

cellular response to DNA damage stimulus (ISO)

cellular response to interferon-alpha (ISO)

cellular response to interferon-beta (IBA,ISO)

DNA-templated transcription (IEA,ISO)

inner ear development (ISO)

negative regulation of B cell proliferation (ISO)

positive regulation of apoptotic process (ISO)

positive regulation of interleukin-1 beta production (IBA)

positive regulation of osteoblast differentiation (ISO)

regulation of transcription by RNA polymerase II (ISO)

response to bacterium (IBA,ISO)

Cellular Component

cytosol (ISO)

intracellular membrane-bounded organelle (ISO)

nuclear inclusion body (ISO)

nuclear periphery (ISO)

nuclear speck (ISO)

nucleolus (IBA,ISO)

nucleoplasm (ISO)

nucleus (ISO)

Molecular Function

double-stranded DNA binding (IBA,ISO)

protein binding (ISO)

transcription coregulator activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:12513910	PMID:15557274	PMID:15896773	PMID:17875758	PMID:19056867	PMID:19158679	PMID:21795542	PMID:23012479	PMID:31505169

Genomics

Comparative Map Data

Mnda
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	13	86,017,888 - 86,035,556 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	86,017,892 - 86,034,201 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	88,525,833 - 88,543,479 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	13	89,926,105 - 89,943,751 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	13	87,110,842 - 87,128,488 (-)	NCBI	Rnor_WKY
Rnor_6.0	13	92,073,664 - 92,091,335 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	92,073,668 - 92,089,980 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	96,545,815 - 96,606,181 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	89,752,997 - 89,770,167 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	89,941,881 - 89,959,051 (-)	NCBI
Celera	13	85,620,545 - 85,638,000 (-)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

MNDA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	158,831,351 - 158,849,502 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	1	158,831,351 - 158,849,506 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	158,801,141 - 158,819,292 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	157,067,792 - 157,085,894 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	155,614,240 - 155,632,343	NCBI
Celera	1	131,871,536 - 131,889,615 (+)	NCBI		Celera
Cytogenetic Map	1	q23.1	NCBI
HuRef	1	130,158,445 - 130,176,628 (+)	NCBI		HuRef
CHM1_1	1	160,197,828 - 160,215,889 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	157,968,444 - 157,986,571 (+)	NCBI		T2T-CHM13v2.0

MNDA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	158,831,351 - 158,849,502 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	1	158,831,351 - 158,849,506 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	158,801,141 - 158,819,292 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	157,067,792 - 157,085,894 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	155,614,240 - 155,632,343	NCBI
Celera	1	131,871,536 - 131,889,615 (+)	NCBI		Celera
Cytogenetic Map	1	q23.1	NCBI
HuRef	1	130,158,445 - 130,176,628 (+)	NCBI		HuRef
CHM1_1	1	160,197,828 - 160,215,889 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	157,968,444 - 157,986,571 (+)	NCBI		T2T-CHM13v2.0

Ifi204
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	173,574,859 - 173,594,606 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	173,574,859 - 173,594,509 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	173,747,293 - 173,767,069 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	173,747,293 - 173,766,943 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	175,677,424 - 175,697,050 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	175,583,971 - 175,603,592 (-)	NCBI		MGSCv36	mm8
Celera	1	176,611,290 - 176,630,307 (-)	NCBI		Celera
Cytogenetic Map	1	H3	NCBI
cM Map	1	80.63	NCBI

Ifi211
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	173,723,907 - 173,740,650 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	173,723,911 - 173,740,612 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	173,896,339 - 173,913,087 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	173,896,345 - 173,913,046 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	175,826,486 - 175,843,053 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	175,733,030 - 175,749,597 (-)	NCBI		MGSCv36	mm8
Cytogenetic Map	1	H3	NCBI

MNDA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	1	137,981,896 - 137,999,850 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	137,992,523 - 137,999,587 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	1	134,190,768 - 134,208,723 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

LOC488622
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	38	22,874,345 - 22,892,362 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	38	22,889,707 - 22,929,512 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	38	22,999,619 - 23,039,476 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	38	22,763,164 - 22,802,846 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	38	23,298,079 - 23,337,779 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	38	23,728,891 - 23,768,811 (-)	NCBI		UU_Cfam_GSD_1.0

MNDA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	5,079,633 - 5,124,967 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	5,079,632 - 5,095,868 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	4,226,792 - 4,271,918 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Mnda
101 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	199
Count of miRNA genes:	129
Interacting mature miRNAs:	140
Transcripts:	ENSRNOT00000036040
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	1	101056920	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	1	101056920	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	101056920	Rat
1581570	Eae17	Experimental allergic encephalomyelitis QTL 17	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	13	8897350	101631289	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	20605871	101339738	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	30395351	101056920	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	31241331	93395974	Rat
12879444	Bp397	Blood pressure QTL 397			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45049404	90049404	Rat
12879471	Bp398	Blood pressure QTL 398			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45514719	90514719	Rat
12879441	Bp396	Blood pressure QTL 396			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45699983	90699983	Rat
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	46088046	91088046	Rat
1641901	Alcrsp6	Alcohol response QTL 6			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	13	52362171	97362171	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	56056920	101056920	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	61825626	106807694	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	65103704	106807694	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	65103704	106807694	Rat
8655945	Rf61	Renal function QTL 61	3.6		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	13	69060519	86800898	Rat
1331783	Bp221	Blood pressure QTL 221	3.72886		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	69060519	86800898	Rat
1300166	Kidm6	Kidney mass QTL 6	3.93		kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	13	69060519	86800898	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	74023918	97213863	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	74862117	101339893	Rat
4889606	Gluco63	Glucose level QTL 63	2.86	0.003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	80753256	106807694	Rat
1302791	Stl29	Serum triglyceride level QTL 29	3.3	0.0011	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	13	84730788	86800898	Rat

Markers in Region

RH128603

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RH 3.4 Map	13	566.2	UniSTS
Cytogenetic Map	13	q24	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	1	5	15	1	17	1					6	10
Low	2	30	38	36	2	36	8	11	1	23	19	1	8
Below cutoff		4							20	10	10

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001012029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC085891	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230439	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000245	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000036040 ⟹ ENSRNOP00000029762

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	86,017,892 - 86,034,201 (-)	Ensembl
Rnor_6.0 Ensembl	13	92,073,668 - 92,089,980 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000097344 ⟹ ENSRNOP00000076437

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	86,020,410 - 86,034,201 (-)	Ensembl

RefSeq Acc Id:

NM_001012029 ⟹ NP_001012029

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	13	86,017,888 - 86,035,556 (-)	NCBI
Rnor_6.0	13	92,073,664 - 92,091,335 (-)	NCBI
Rnor_5.0	13	96,545,815 - 96,606,181 (-)	NCBI
RGSC_v3.4	13	89,752,997 - 89,770,167 (-)	RGD
Celera	13	85,620,545 - 85,638,000 (-)	RGD

Sequence:

show sequence

CCAGGGACTAAACCACCATCCAAAGAGTACACATGGATAGACCCATGGCTCCAGCGGCATATAT
AACAGAAGATGGCCTTGTTGGGCACCAATGGGAGGAGAAGCATTTGGTCCTGCCAAGGCTCGAC
CCCCGAGTATAAAGGCGGTCAAACCAAACAAGCCACTGCTTGGGTCACTGAAGGTCTTGGGATC
CGAACATCGCTGCAGAGATTTCAAGGGAGGCTCACCCAACAACTTGAAAGATGTCAAATGAATA
TAAGAGAATCGTTCTGTTGAAAGGACTTGAACCTCTCAGTAGTCATCATTTTAGCTTATTTAAG
TCATTGCTGGCCAGTGATTTAAAACTGGAGAGACACATGCAGGAGCAATACACCAAGGTCCAGA
TTGCTGACATGATGGAAGATGAATTCCCAGATGATGCTGGATTGGGCAAATTCATCAAATTTTG
TGAAGACTTACCAGCTCTTAGAAAACGTGCTGAAATTCTTAAAAGAGAGAGAATACAAGTAAGA
GGAGAAACCCCACGGGAAATAAATAGGCGAGAACCAGGTCCGTCAAGACCTTCATCAACTGCAA
GCCATATGATAGTGTCTGAAGGATGGGAGACTTCCACAGCTCAGGCAGAGACCTCCACAGCTCA
GGGAGAGCCTTCTACAGCTCAGAAAAGAAAAAGTATGAGCGAAGGAAAGACTGAAGTGAAAAAG
ACCAAGGCATCAGAGAGACCAGATCAGCCTCCCTGTCCTGAAGAAGCCACAGCCAAGTGTCTGT
CACCAATACCCCAGACTTCGTCTTTGGCTCCATGTAACTCTCCTTTGGCTAAGTGTTCAATGGA
GAACCAAAATATACAGACCCAAAACCAGAACATTCCCAGAGGCGCTGTTCTCCAAACAGAACCC
CTGACAGTGATGGTGCTCAAAGCAACAGACCCATTTGAATATGAATCAGCAGAACATGGAGTGA
AGAACATGTTTCTTGCTACAGTGGTTACTGTAGACCGGTATTTCCATGTGAAAGTTTTCAACAG
CAACTTGAAAGAGAAGTTCAAAAAAAATAATTTTATCATCATTTCCAATTACTTCAAGAGGACA
GACATCCTAGAGATCAATGAAGCTTCCCTTGTGTCAGAGGCTGCTCCTGACAAAAAGATTGCAG
TGCCCAACAAACGTATCAAAGAGGCAAAAAAATCTCCTAAAATCCGTGATATTAAAGAGGGTAC
TTCAAGGGATCTGTTTTATGGAGTGTTTACATTAATCAAGAAAAAAGTGTGCCCAAAGAACACA
ATCTATGAACTAAAAGATGATACAGGAAATATAGAAGTGGTGGGGAGTGGAAAATGGTACAACA
TCAACTGTAACGAAGGAGATAACTTCCAACTCTTCTGCTTTCACCTGAAAACAATTGACAGGCA
ACAAAAATTAGTGTGTGGAAAGCACAGTTTTATCAAGGTCACCAGAGCTCGGGAAAAAAAGGAA
GCAGCCACTGCCCATCCAAGCACAAAAAAGGAAGAAGGAACTCACTACCCTAAAGACAAATTCA
ATGCTTTTAAAGAAGAGAAATAAAACGATCATGTCTAAATAATAGCTTTAGTAGTACATTCAAG
CATTTAATGGTTTTCATAACTGACTTCTGATTTTGTATTTCCATTTGCAACGTTTTTTATTCTT
CTGTTTTTCTATGAAAATAGCACTTGATTTAATTTTTCTATTGTAAAAGTAATAAACATCTTTT
TAAAGGGACATCAATAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001012029	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH85891	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_001012029 ⟸ NM_001012029

- UniProtKB:

Q5U2R8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSNEYKRIVLLKGLEPLSSHHFSLFKSLLASDLKLERHMQEQYTKVQIADMMEDEFPDDAGLGK
FIKFCEDLPALRKRAEILKRERIQVRGETPREINRREPGPSRPSSTASHMIVSEGWETSTAQAE
TSTAQGEPSTAQKRKSMSEGKTEVKKTKASERPDQPPCPEEATAKCLSPIPQTSSLAPCNSPLA
KCSMENQNIQTQNQNIPRGAVLQTEPLTVMVLKATDPFEYESAEHGVKNMFLATVVTVDRYFHV
KVFNSNLKEKFKKNNFIIISNYFKRTDILEINEASLVSEAAPDKKIAVPNKRIKEAKKSPKIRD
IKEGTSRDLFYGVFTLIKKKVCPKNTIYELKDDTGNIEVVGSGKWYNINCNEGDNFQLFCFHLK
TIDRQQKLVCGKHSFIKVTRAREKKEAATAHPSTKKEEGTHYPKDKFNAFKEEK

hide sequence

RefSeq Acc Id:

ENSRNOP00000029762 ⟸ ENSRNOT00000036040

RefSeq Acc Id:

ENSRNOP00000076437 ⟸ ENSRNOT00000097344

Protein Domains

HIN-200 Pyrin

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5U2R8-F1-model_v2	AlphaFold	Q5U2R8	1-438	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306089	AgrOrtholog
BioCyc Gene	G2FUF-17270	BioCyc
Ensembl Genes	ENSRNOG00000003486	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000029762	ENTREZGENE
	ENSRNOP00000029762.3	UniProtKB/TrEMBL
	ENSRNOP00000076437.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000036040	ENTREZGENE
	ENSRNOT00000036040.4	UniProtKB/TrEMBL
	ENSRNOT00000097344.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.533.10	UniProtKB/TrEMBL
	2.40.50.140	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7192620	IMAGE-MGC_LOAD
InterPro	DEATH-like_dom_sf	UniProtKB/TrEMBL
	HIN-200	UniProtKB/TrEMBL
	HIN200/IF120x	UniProtKB/TrEMBL
	NA-bd_OB-fold	UniProtKB/TrEMBL
	Pyrin	UniProtKB/TrEMBL
KEGG Report	rno:304988	UniProtKB/TrEMBL
MGC_CLONE	MGC:94687	IMAGE-MGC_LOAD
NCBI Gene	304988	ENTREZGENE
PANTHER	PTHR12200	UniProtKB/TrEMBL
Pfam	HIN	UniProtKB/TrEMBL
	PAAD_DAPIN	UniProtKB/TrEMBL
PhenoGen	Mnda	PhenoGen
PROSITE	DAPIN	UniProtKB/TrEMBL
	HIN_200	UniProtKB/TrEMBL
SMART	PYRIN	UniProtKB/TrEMBL
UniProt	A0A8I5Y087_RAT	UniProtKB/TrEMBL
	Q5U2R8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-07-09	Mnda	myeloid cell nuclear differentiation antigen	Ifi204	interferon activated gene 204	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-06	Ifi204	interferon activated gene 204	Mnda	myeloid cell nuclear differentiation antigen	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Mnda	myeloid cell nuclear differentiation antigen	Mnda_predicted	myeloid cell nuclear differentiation antigen (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Mnda_predicted	myeloid cell nuclear differentiation antigen (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD