Slc10a5 (solute carrier family 10, member 5)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Slc10a5 (solute carrier family 10, member 5) Rattus norvegicus

Analyze

Symbol:

Slc10a5

Name:

solute carrier family 10, member 5

RGD ID:

1306036

Description:

Predicted to enable bile acid:sodium symporter activity. Predicted to be involved in bile acid and bile salt transport. Predicted to be located in membrane. Orthologous to human SLC10A5 (solute carrier family 10 member 5); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC310230; Na(+)/bile acid cotransporter 5; sodium/bile acid cotransporter 5; solute carrier family 10 (sodium/bile acid cotransporter family), member 5; solute carrier family 10 member 5

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	91,457,540 - 91,458,844 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	91,444,454 - 91,489,651 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	97,948,037 - 97,949,341 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	96,069,025 - 96,070,329 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	91,125,877 - 91,127,181 (+)	NCBI	Rnor_WKY
Rnor_6.0	2	93,669,962 - 93,671,266 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	93,669,765 - 93,671,457 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	113,425,482 - 113,426,786 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	93,410,717 - 93,412,021 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	93,355,678 - 93,356,981 (+)	NCBI
Celera	2	87,060,601 - 87,061,905 (+)	NCBI		Celera
Cytogenetic Map	2	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

aflatoxin B1 (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

cisplatin (ISO)

endosulfan (EXP,ISO)

furan (EXP)

gentamycin (EXP)

O-methyleugenol (ISO)

paracetamol (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenformin (EXP)

rotenone (EXP)

sodium arsenite (ISO)

sotorasib (ISO)

sunitinib (ISO)

tetrachloromethane (EXP)

trametinib (ISO)

trichloroethene (EXP)

triptonide (ISO)

tris(2-butoxyethyl) phosphate (ISO)

valproic acid (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

bile acid and bile salt transport (IBA)

sodium ion transport (IEA)

transmembrane transport (IEA)

Cellular Component

membrane (IEA)

Molecular Function

bile acid:sodium symporter activity (IBA)

symporter activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:17632081

Genomics

Comparative Map Data

Slc10a5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	91,457,540 - 91,458,844 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	91,444,454 - 91,489,651 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	97,948,037 - 97,949,341 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	96,069,025 - 96,070,329 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	91,125,877 - 91,127,181 (+)	NCBI	Rnor_WKY
Rnor_6.0	2	93,669,962 - 93,671,266 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	93,669,765 - 93,671,457 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	113,425,482 - 113,426,786 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	93,410,717 - 93,412,021 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	93,355,678 - 93,356,981 (+)	NCBI
Celera	2	87,060,601 - 87,061,905 (+)	NCBI		Celera
Cytogenetic Map	2	q23	NCBI

SLC10A5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	81,693,631 - 81,695,058 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	8	81,693,631 - 81,695,058 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	82,605,866 - 82,607,293 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	82,768,446 - 82,769,762 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	8	78,610,394 - 78,611,710 (-)	NCBI		Celera
Cytogenetic Map	8	q21.13	NCBI
HuRef	8	78,095,784 - 78,097,100 (-)	NCBI		HuRef
CHM1_1	8	82,657,512 - 82,658,828 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	82,125,341 - 82,126,768 (-)	NCBI		T2T-CHM13v2.0

Slc10a5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	10,396,794 - 10,400,716 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	10,396,794 - 10,400,716 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	10,331,734 - 10,335,656 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	10,331,734 - 10,335,656 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	10,331,734 - 10,335,656 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	10,314,266 - 10,318,188 (-)	NCBI		MGSCv36	mm8
Celera	3	10,365,844 - 10,369,766 (-)	NCBI		Celera
Cytogenetic Map	3	A1	NCBI

Slc10a5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955417	40,256 - 48,658 (-)	NCBI	ChiLan1.0	ChiLan1.0

LOC100977552
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	8	73,056,611 - 73,062,572 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	78,215,841 - 78,220,679 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	79,835,979 - 79,838,671 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

SLC10A5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	29	28,800,120 - 28,806,672 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
ROS_Cfam_1.0	29	28,932,315 - 28,938,877 (-)	NCBI		ROS_Cfam_1.0

Slc10a5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	50,400,644 - 50,402,117 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936656	2,591,159 - 2,592,469 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936656	2,591,155 - 2,592,469 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLC10A5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	4	54,933,929 - 54,935,841 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

Slc10a5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624744	9,809,098 - 9,817,986 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Slc10a5
7 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	22
Count of miRNA genes:	19
Interacting mature miRNAs:	22
Transcripts:	ENSRNOT00000045438
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	5873687	102844969	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	25413423	143657569	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	127469484	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	26917817	136917119	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	40067944	102785628	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	157142209	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	43154682	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
2293676	Bmd19	Bone mineral density QTL 19	10.7	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	43162366	111362592	Rat
2293682	Bmd24	Bone mineral density QTL 24	8.9	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	2	43162366	111362592	Rat
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	43162366	148478373	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
1558648	Smcn1	Smooth muscle cell number QTL 1		0.039	blood vessel smooth muscle cell quantity (VT:0010525)	aorta smooth muscle cell count per unit vessel length (CMO:0001646)	2	59134147	127460910	Rat
5684990	Bmd82	Bone mineral density QTL 82	2.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	2	59324377	103795077	Rat
5684996	Bmd85	Bone mineral density QTL 85	4.7	0.024	tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	2	59324377	103795077	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	59324377	141596857	Rat
631500	Bp99	Blood pressure QTL 99	2.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	59324719	102755241	Rat
1578777	Stresp15	Stress response QTL 15	2	0.05	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	2	59846005	104846005	Rat
2306903	Bp336	Blood pressure QTL 336		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	64366971	109366971	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
7411551	Bw131	Body weight QTL 131	29.6	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	2	67942638	112942638	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	72532993	157142209	Rat
1359034	Bp274	Blood pressure QTL 274			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	74786664	94359546	Rat
1359034	Bp274	Blood pressure QTL 274			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	74786664	94359546	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
61465	Bp13	Blood pressure QTL 13	3.3		blood pressure trait (VT:0000183)	diastolic blood pressure (CMO:0000005)	2	76539322	102785628	Rat
61465	Bp13	Blood pressure QTL 13	3.3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	76539322	102785628	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	76539322	150540526	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
2299162	Iddm32	Insulin dependent diabetes mellitus QTL 32	2.36		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	78665616	143657569	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61392	Bp6	Blood pressure QTL 6	7		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	80270434	125270434	Rat
1598865	Bp296	Blood pressure QTL 296	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	81018907	126018907	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
1578772	Stresp14	Stress response QTL 14	5	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	2	82345893	130923501	Rat
7207808	Bmd89	Bone mineral density QTL 89	4.1		femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	2	88862519	133862519	Rat
2300165	Bmd49	Bone mineral density QTL 49	4.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	2	88862519	133862519	Rat
2300170	Bmd45	Bone mineral density QTL 45	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	2	88862519	133862519	Rat
2300185	Bmd46	Bone mineral density QTL 46	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	88862519	133862519	Rat

Markers in Region

RH141896

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	91,455,647 - 91,455,831 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	93,668,070 - 93,668,253	NCBI	Rnor6.0
Rnor_5.0	2	113,423,590 - 113,423,773	UniSTS	Rnor5.0
RGSC_v3.4	2	93,408,825 - 93,409,008	UniSTS	RGSC3.4
Celera	2	87,058,709 - 87,058,892	UniSTS
RH 3.4 Map	2	573.3	UniSTS
Cytogenetic Map	2	q23	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			8	8		8				14
Low	3	43	49	33	19	33	6	6	74	21	38	11	6
Below cutoff							2	4			3		2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025280	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	DQ074435	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000067	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000045438 ⟹ ENSRNOP00000051406

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	2	93,669,765 - 93,671,457 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000104668 ⟹ ENSRNOP00000081321

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	91,444,454 - 91,489,651 (+)	Ensembl

RefSeq Acc Id:

NM_001025280 ⟹ NP_001020451

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	91,457,540 - 91,458,844 (+)	NCBI
Rnor_6.0	2	93,669,962 - 93,671,266 (+)	NCBI
Rnor_5.0	2	113,425,482 - 113,426,786 (+)	NCBI
RGSC_v3.4	2	93,410,717 - 93,412,021 (+)	RGD
Celera	2	87,060,601 - 87,061,905 (+)	RGD

Sequence:

show sequence

ATGTCTGGAAAACTTTTCATAATTCTCCTTTTGTTGGTGACCCCGGGAGAAGCAAGGAAGTCAT
TTCTCAGATTTCTGAATATACAAAATCCAGAAATGCTGTCGTTTACGAAGCCAGAAGAAACCGT
CATTGTAAGGTCCAGCTATGAAGGTAAGCGGCCTCACTCCAGCTACCTGCTTGTGAAGTTGGAG
GATCCTACAGTGCTGCAGGTGGTGAATGTGACCAAGACCTCCCTGGACTTCACAGACTTCACCA
TCAACCTGAAGACGTTCCCAGGAGAGACAAACCTCACCATGCAGCTCTGGGAGTCTGAAGGTAG
GCAAACAAGACTCATCGAAGAGATAACCAATATCAGAGTGAGCGTGTTCAGACAGACAGAGGAC
AGTCTCTTCCAGGAACCAATCCACGTCAACAGCTCCGTCTTCCTGCTTGTCTTATTGATGATCC
TTTTAAATAAATGCGCCTTTGGCTGCAAGATTGAATTACAGGTGCTCCAAACAGTGTGGAAGAG
ACCTTTGCCAATACTTCTTGGGGCGGTTACACAGTTTTTTCTTATGCCGTTCTGTGGCTTTCTC
TTGTCTCAGATTTTGGGCTTGTCAAAGGCACAGGCTTTTGGATTTGTAATGACCTGCACATGCC
CAGGAGGGGGTGGGGGCTATCTCTTTGCTCTCCTTCTAGAAGGGGACGTCACTTTGGCCATTTT
GATGGCTTGCACGTCAACGTCCCTGGCCCTCATCATGATGCCTGTCAACTCGTACTTATACAGT
TGCCTACTCGGGTTAGCAGGTGTATTTCACGTTCCTGTCTTAAAGATTGTGTCTACTCTTCTTT
TCATACTTACGCCAGTATCCATCGGCATAGTCATTAAGCACAGAATGCCTAAAAAAGCAGTCTG
TCTAGAGAGAGTGGTGCAGCCTCTGAGTTTGACTTTAATGTTGGTGGGAGTCTACTTGGCTTTC
AGGATGGGACTGGTGTTTCTGAGAATGGCTAACCTAGAGGTGTTTCTTTTGGGGCTTCTGGTTC
CCGTACTGGGCTTTTCATTTGGGTATTCCTTTGCTAAAGTCTACCTGCTGCCGCTTCCTGTTTG
CAAAACAGTCGCAATCGAAAGTGGGATGTTGAATAGTTTCTTAGCCCTGGCCATTATTCAGCTT
TCTTTTCCACAGTCCAAGGCATATGAGGCCTCCGTGGCTCCTTTTACAGTAGCGATGTGTTCTA
GCTGTGAAATGTTGCTGCTCCTTCTGGTCTACAAGGCTAAGAAGAGGCCACTCCTTAGCACAGA
AAATGAAAAGGCTCCTCTCGTTTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001020451	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAY85181	(Get FASTA)	NCBI Sequence Viewer
	Q4JLT5	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001020451 ⟸ NM_001025280
- Peptide Label:	precursor
- UniProtKB:	Q4JLT5 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MSGKLFIILLLLVTPGEARKSFLRFLNIQNPEMLSFTKPEETVIVRSSYEGKRPHSSYLLVKLE DPTVLQVVNVTKTSLDFTDFTINLKTFPGETNLTMQLWESEGRQTRLIEEITNIRVSVFRQTED SLFQEPIHVNSSVFLLVLLMILLNKCAFGCKIELQVLQTVWKRPLPILLGAVTQFFLMPFCGFL LSQILGLSKAQAFGFVMTCTCPGGGGGYLFALLLEGDVTLAILMACTSTSLALIMMPVNSYLYS CLLGLAGVFHVPVLKIVSTLLFILTPVSIGIVIKHRMPKKAVCLERVVQPLSLTLMLVGVYLAF RMGLVFLRMANLEVFLLGLLVPVLGFSFGYSFAKVYLLPLPVCKTVAIESGMLNSFLALAIIQL SFPQSKAYEASVAPFTVAMCSSCEMLLLLLVYKAKKRPLLSTENEKAPLV hide sequence

RefSeq Acc Id:

ENSRNOP00000051406 ⟸ ENSRNOT00000045438

RefSeq Acc Id:

ENSRNOP00000081321 ⟸ ENSRNOT00000104668

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4JLT5-F1-model_v2	AlphaFold	Q4JLT5	1-434	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691233

Promoter ID:

EPDNEW_R1757

Type:

multiple initiation site

Name:

Slc10a5_1

Description:

solute carrier family 10, member 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	93,669,858 - 93,669,918	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306036	AgrOrtholog
BioCyc Gene	G2FUF-53758	BioCyc
Ensembl Genes	ENSRNOG00000032426	Ensembl
	ENSRNOG00000067758	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000081321	ENTREZGENE
	ENSRNOP00000081321.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000104668	ENTREZGENE
	ENSRNOT00000104668.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.1530.20	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	BilAc:Na_symport/Acr3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Bilac:Na_transpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Na+/solute_symporter_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:310230	UniProtKB/Swiss-Prot
NCBI Gene	310230	ENTREZGENE
PANTHER	PTHR10361	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10361:SF29	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	SBF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Slc10a5	PhenoGen
UniProt	A0A8I6G7T7_RAT	UniProtKB/TrEMBL
	NTCP5_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-08-02	Slc10a5	solute carrier family 10, member 5	Slc10a5	solute carrier family 10 (sodium/bile acid cotransporter family), member 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Slc10a5	solute carrier family 10 (sodium/bile acid cotransporter family), member 5	Slc10a5_predicted	solute carrier family 10 (sodium/bile acid cotransporter family), member 5 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Slc10a5_predicted	solute carrier family 10 (sodium/bile acid cotransporter family), member 5 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar