Mfap2 (microfibril associated protein 2)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Mfap2 (microfibril associated protein 2) Rattus norvegicus

Analyze

Symbol:

Mfap2

Name:

microfibril associated protein 2

RGD ID:

1306031

Description:

Predicted to enable fibrinogen binding activity and fibronectin binding activity. Predicted to be involved in embryonic eye morphogenesis; positive regulation of cold-induced thermogenesis; and post-embryonic eye morphogenesis. Predicted to act upstream of or within platelet formation. Predicted to be located in extracellular region. Predicted to be active in microfibril. Orthologous to human MFAP2 (microfibril associated protein 2); PARTICIPATES IN Notch signaling pathway; INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC313662; microfibrillar-associated protein 2

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	153,312,068 - 153,320,266 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	153,314,711 - 153,320,259 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	156,003,158 - 156,008,692 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	157,776,429 - 157,781,963 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	157,765,613 - 157,771,147 (+)	NCBI	Rnor_WKY
Rnor_6.0	5	159,534,202 - 159,539,750 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	159,534,202 - 159,539,750 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	163,246,454 - 163,252,003 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	159,868,933 - 159,874,481 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	159,879,913 - 159,884,266 (+)	NCBI
Celera	5	151,679,623 - 151,685,290 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

chromosome 1p36 deletion syndrome (ISO)

genetic disease (ISO)

ovarian cyst (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

5-azacytidine (ISO)

6-propyl-2-thiouracil (EXP)

9-cis-retinoic acid (ISO)

aconitine (EXP)

acrylamide (EXP,ISO)

all-trans-4-oxoretinoic acid (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

C60 fullerene (EXP)

calcitriol (ISO)

choline (ISO)

chrysene (ISO)

ciguatoxin CTX1B (ISO)

copper atom (ISO)

copper(0) (ISO)

Cuprizon (EXP)

dexamethasone (ISO)

dibutyl phthalate (EXP)

dimethylarsinic acid (ISO)

diuron (EXP)

doxorubicin (ISO)

elemental selenium (ISO)

endosulfan (EXP)

folic acid (ISO)

furan (EXP)

hexane (EXP)

Indeno[1,2,3-cd]pyrene (ISO)

isotretinoin (ISO)

L-methionine (ISO)

manganese(II) chloride (EXP)

methapyrilene (ISO)

N-methyl-4-phenylpyridinium (EXP,ISO)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

progesterone (ISO)

resveratrol (ISO)

selenium atom (ISO)

silicon dioxide (ISO)

sulforaphane (ISO)

sunitinib (ISO)

tamoxifen (ISO)

temozolomide (ISO)

testosterone (EXP,ISO)

tetraphene (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

valproic acid (ISO)

vanadium atom (ISO)

vanadium(0) (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

embryonic eye morphogenesis (IBA,ISO)

platelet formation (ISO)

positive regulation of cold-induced thermogenesis (ISO,ISS)

post-embryonic eye morphogenesis (ISO)

Cellular Component

extracellular region (IEA)

microfibril (IBA,ISO)

Molecular Function

fibrinogen binding (ISO)

fibronectin binding (ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Notch signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The extracellular matrix protein MAGP1 supports thermogenesis and protects against obesity and diabetes through regulation of TGF-ß.	Craft CS, etal., Diabetes. 2014 Jun;63(6):1920-32. doi: 10.2337/db13-1604. Epub 2014 Jan 23.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:18281502	PMID:24353434	PMID:25406291	PMID:26405179

Genomics

Comparative Map Data

Mfap2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	153,312,068 - 153,320,266 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	153,314,711 - 153,320,259 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	156,003,158 - 156,008,692 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	157,776,429 - 157,781,963 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	157,765,613 - 157,771,147 (+)	NCBI	Rnor_WKY
Rnor_6.0	5	159,534,202 - 159,539,750 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	159,534,202 - 159,539,750 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	163,246,454 - 163,252,003 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	159,868,933 - 159,874,481 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	159,879,913 - 159,884,266 (+)	NCBI
Celera	5	151,679,623 - 151,685,290 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

MFAP2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	16,974,502 - 16,981,583 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	1	16,974,502 - 16,980,632 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	17,300,997 - 17,308,078 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	17,173,584 - 17,180,668 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	15,623,335 - 15,630,419 (-)	NCBI		Celera
Cytogenetic Map	1	p36.13	NCBI
HuRef	1	15,545,079 - 15,552,161 (-)	NCBI		HuRef
CHM1_1	1	17,409,311 - 17,416,419 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	16,784,929 - 16,792,008 (-)	NCBI		T2T-CHM13v2.0

Mfap2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	140,737,735 - 140,743,286 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	140,737,729 - 140,743,295 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	141,010,424 - 141,015,976 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	141,010,418 - 141,015,984 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	140,566,339 - 140,571,899 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	140,282,779 - 140,288,049 (+)	NCBI		MGSCv36	mm8
Celera	4	142,810,410 - 142,815,979 (+)	NCBI		Celera
Cytogenetic Map	4	D3	NCBI

Mfap2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955527	1,826,528 - 1,832,052 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955527	1,826,528 - 1,832,058 (+)	NCBI	ChiLan1.0	ChiLan1.0

MFAP2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	1	209,268,574 - 209,274,736 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	15,918,209 - 15,924,388 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1 Ensembl	1	16,975,544 - 17,006,022 (-)	Ensembl	panpan1.1		panPan2

MFAP2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	81,217,197 - 81,223,726 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	81,220,431 - 81,224,243 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	77,753,979 - 77,760,380 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	81,863,358 - 81,869,768 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	81,866,473 - 81,869,582 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	78,616,367 - 78,622,775 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	79,633,264 - 79,639,634 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	80,701,361 - 80,707,780 (+)	NCBI		UU_Cfam_GSD_1.0

Mfap2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	38,135,115 - 38,139,943 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	3,956,095 - 3,963,253 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936474	3,959,499 - 3,963,326 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MFAP2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	75,607,521 - 75,615,641 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	75,607,515 - 75,615,680 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	69,920,815 - 69,928,972 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MFAP2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	115,610,590 - 115,616,983 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	115,610,808 - 115,617,506 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	503,565 - 510,642 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mfap2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	2,606,138 - 2,611,732 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	2,606,089 - 2,611,738 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Mfap2
45 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	68
Count of miRNA genes:	54
Interacting mature miRNAs:	58
Transcripts:	ENSRNOT00000010993
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	143069996	166846814	Rat
2302369	Scl60	Serum cholesterol level QTL 60	3.13		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	143608201	161165651	Rat
631263	Cm24	Cardiac mass QTL 24	3.5		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	143799107	158428037	Rat
1300119	Bp180	Blood pressure QTL 180	3.82		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	144358090	157869054	Rat
2313096	Bmd78	Bone mineral density QTL 78	3.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	5	144377876	161317411	Rat
1298090	Bp155	Blood pressure QTL 155	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	151006154	161165494	Rat
1354631	Swd2	Spike wave discharge measurement QTL 2	3.64	0.0002	brain electrophysiology trait (VT:0010557)	brain total spike-and-wave discharge duration (CMO:0001740)	5	151113452	164465185	Rat
631272	Lanf1	Left ventricular atrial natriuretic factor QTL 1	12		heart left ventricle natriuretic peptide A amount (VT:0010596)	heart left ventricle natriuretic peptide A level (CMO:0002165)	5	151113452	166875058	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		31	13	12		12	2	4	53	22	33	7	2
Low	3	12	34	19	19	19	6	7	21	13	8	4	6
Below cutoff			10	10		10

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107989	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110070	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110072	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC134642	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000010993 ⟹ ENSRNOP00000010993

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	153,314,711 - 153,320,259 (+)	Ensembl
Rnor_6.0 Ensembl	5	159,534,202 - 159,539,750 (+)	Ensembl

RefSeq Acc Id:

NM_001107989 ⟹ NP_001101459

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	153,314,711 - 153,320,259 (+)	NCBI
Rnor_6.0	5	159,534,202 - 159,539,750 (+)	NCBI
Rnor_5.0	5	163,246,454 - 163,252,003 (+)	NCBI
RGSC_v3.4	5	159,868,933 - 159,874,481 (+)	RGD
Celera	5	151,679,623 - 151,685,290 (+)	RGD

Sequence:

show sequence

ACTCTCAGCTGCACTAGAGCACAGCGCAGAGGCCCCAACAGCTGCCCTCAACGCCCCACTGCCT
CCTCACCTCATGGCCATGAGAGCTGCCTGCCTCTTCCTGCTCTTCTTGCCTGGCCTGCTGGCTC
AGGGCCAATACGACCTGGATCCTCTCCCGCCGTTCCCGGACCATGTCCAGTACAACCACTATGG
CGACCAGATAGAGAACGCAGACTACTATGACTACCAAGAAGTGAGTTCTCGGCCCCCTGAGGAA
CAGTTCCAGTCCCAGCAGCAAGTACCACAGGAAGTTATCCCAGCTCCTACCCCAGAACTGCCAG
CTGCAGGGGACCAGGACACCGAGCCCACGGAGCCTGGCCCTCTTGACTGCCGTGAAGAACAGTA
CCCATGTACCCGCCTCTACTCCATCCACAAGCCTTGTAAACAGTGTCTCAATGAGGTCTGCTTC
TACAGCCTCCGAAGAGTATATGTGGTCAACAAGGAAATATGTGTCCGCACAGTCTGTGCCCATG
AGGAACTTCTCCGAGCTGACCTGTGCCGAGACAAGTTCTCCAAGTGTGGTGTGATAGCCAACAG
TGGCCTGTGCCAGTCTGTGGCTGCCTCCTGTGCCAGGAGCTGTGGGGGCTGCTAGGGTGGAGCT
GGTGCGAGATTCGAGCCCTGGACCCAGCTCGGATCCACCTCAGGCCCTGCCTGACCTGGTGCTT
TCTCTCCCATCTTGCCCTCCCTTTCATCCCGGACATCAGTGGGCTGCTGCCCTGGGGAGTGTGG
GCATAGCTGCCTTGGGCCCCTTCCCAGCCTGTGGCCATCCCTAAGTGGGGGCTCCTGACTGTCC
AGTCTCCACCCCTTAATGGGGTTCATCCAAGGCCTCTTTGTGAGGCCTGGGGTTCTCACTGTGC
CTTCTCAGTGCCTGGGGGCAGTCCTCCTCAGTCTCCTCAGGTAGGCTGTGCCCCTTACCCAGCT
GGTCTGCTTGGATTTCCCACGCCCCCAGGCATGGATCACCTGTTTTATACAAAATAATAAAGTT
TTTACAAAAG

hide sequence

RefSeq Acc Id:

XM_039110070 ⟹ XP_038965998

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	153,312,068 - 153,320,266 (+)	NCBI

RefSeq Acc Id:

XM_039110072 ⟹ XP_038966000

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	153,312,068 - 153,320,266 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001101459	(Get FASTA)	NCBI Sequence Viewer
	XP_038965998	(Get FASTA)	NCBI Sequence Viewer
	XP_038966000	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL80959	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001101459 ⟸ NM_001107989
- Peptide Label:	precursor
- UniProtKB:	D3Z952 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAMRAACLFLLFLPGLLAQGQYDLDPLPPFPDHVQYNHYGDQIENADYYDYQEVSSRPPEEQFQ SQQQVPQEVIPAPTPELPAAGDQDTEPTEPGPLDCREEQYPCTRLYSIHKPCKQCLNEVCFYSL RRVYVVNKEICVRTVCAHEELLRADLCRDKFSKCGVIANSGLCQSVAASCARSCGGC hide sequence

RefSeq Acc Id:

ENSRNOP00000010993 ⟸ ENSRNOT00000010993

RefSeq Acc Id:	XP_038965998 ⟸ XM_039110070
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038966000 ⟸ XM_039110072
- Peptide Label:	isoform X2

Protein Domains

ShKT

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3Z952-F1-model_v2	AlphaFold	D3Z952	1-185	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694218

Promoter ID:

EPDNEW_R4741

Type:

single initiation site

Name:

Mfap2_1

Description:

microfibril associated protein 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	159,534,202 - 159,534,262	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306031	AgrOrtholog
BioCyc Gene	G2FUF-39373	BioCyc
Ensembl Genes	ENSRNOG00000008257	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000010993	ENTREZGENE
	ENSRNOP00000010993.5	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000010993	ENTREZGENE
	ENSRNOT00000010993.6	UniProtKB/TrEMBL
InterPro	MAGP	UniProtKB/TrEMBL
	ShKT_dom	UniProtKB/TrEMBL
KEGG Report	rno:313662	UniProtKB/TrEMBL
NCBI Gene	313662	ENTREZGENE
PANTHER	MAGP	UniProtKB/TrEMBL
	MICROFIBRILLAR-ASSOCIATED PROTEIN 2	UniProtKB/TrEMBL
Pfam	MAGP	UniProtKB/TrEMBL
PhenoGen	Mfap2	PhenoGen
PROSITE	SHKT	UniProtKB/TrEMBL
UniProt	D3Z952	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-06-13	Mfap2	microfibril associated protein 2	Mfap2	microfibrillar-associated protein 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Mfap2	microfibrillar-associated protein 2	Mfap2_predicted	microfibrillar-associated protein 2 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Mfap2_predicted	microfibrillar-associated protein 2 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - PID (archival)