Advanced Search (OLGA)

Gene: Armc10 (armadillo repeat containing 10) Rattus norvegicus

Analyze

Symbol:

Armc10

Name:

armadillo repeat containing 10

RGD ID:

1305915

Description:

Predicted to enable DNA binding domain binding activity and p53 binding activity. Predicted to be involved in negative regulation of intrinsic apoptotic signaling pathway by p53 class mediator and positive regulation of growth rate. Predicted to be located in endoplasmic reticulum. Predicted to be active in mitochondrion. Orthologous to human ARMC10 (armadillo repeat containing 10); INTERACTS WITH 6-propyl-2-thiouracil; amitrole; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

2810037c14rik; armadillo repeat-containing protein 10; LOC296758; RGD1305915; similar to RIKEN cDNA 2810037C14; SVH protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ARMC10 (armadillo repeat containing 10)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Armc10 (armadillo repeat containing 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Armc10 (armadillo repeat containing 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ARMC10 (armadillo repeat containing 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ARMC10 (armadillo repeat containing 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Armc10 (armadillo repeat containing 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ARMC10 (armadillo repeat containing 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ARMC10 (armadillo repeat containing 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Armc10 (armadillo repeat containing 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Armc10 (armadillo repeat containing 10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ARMC10 (armadillo repeat containing 10)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	armc10 (armadillo repeat containing 10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y67A10A.7	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	armc10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	14,291,211 - 14,306,799 (-)	NCBI		GRCr8
mRatBN7.2	4	13,399,004 - 13,414,594 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	13,395,207 - 13,414,548 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	18,538,827 - 18,554,481 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	14,347,333 - 14,362,905 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	12,724,470 - 12,740,124 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	10,004,846 - 10,020,017 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	10,004,848 - 10,020,022 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	10,006,005 - 10,021,176 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	8,848,308 - 8,862,081 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	8,848,395 - 8,921,800 (-)	NCBI
Celera	4	8,977,683 - 8,991,195 (-)	NCBI		Celera
Cytogenetic Map	4	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

pleomorphic xanthoastrocytoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

atrazine (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP,ISO)

CGP 52608 (ISO)

chromium(6+) (ISO)

cobalt dichloride (EXP)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (ISO)

deoxynivalenol (ISO)

Dibutyl phosphate (ISO)

formaldehyde (ISO)

FR900359 (ISO)

genistein (ISO)

gentamycin (EXP)

ivermectin (ISO)

ketamine (EXP)

methimazole (EXP)

methyl methanesulfonate (ISO)

nitrates (ISO)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

resveratrol (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

tamoxifen (ISO)

thiram (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of apoptotic process (ISO)

negative regulation of intrinsic apoptotic signaling pathway by p53 class mediator (ISO)

positive regulation of growth rate (ISO)

Cellular Component

endoplasmic reticulum (IEA,ISO)

endoplasmic reticulum membrane (IEA)

membrane (IEA)

mitochondrial outer membrane (IEA)

mitochondrion (IBA,IEA,ISO)

Molecular Function

DNA binding domain binding (ISO)

p53 binding (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8889548	PMID:12477932	PMID:12839973	PMID:17904127	PMID:18614015

Genomics

Comparative Map Data

Armc10
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	14,291,211 - 14,306,799 (-)	NCBI		GRCr8
mRatBN7.2	4	13,399,004 - 13,414,594 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	13,395,207 - 13,414,548 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	18,538,827 - 18,554,481 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	14,347,333 - 14,362,905 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	12,724,470 - 12,740,124 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	10,004,846 - 10,020,017 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	10,004,848 - 10,020,022 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	10,006,005 - 10,021,176 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	8,848,308 - 8,862,081 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	8,848,395 - 8,921,800 (-)	NCBI
Celera	4	8,977,683 - 8,991,195 (-)	NCBI		Celera
Cytogenetic Map	4	q11	NCBI

ARMC10
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	103,075,140 - 103,099,759 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	103,074,881 - 103,099,759 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	102,715,587 - 102,740,206 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	102,502,564 - 102,527,441 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	7	97,523,222 - 97,548,131 (+)	NCBI		Celera
Cytogenetic Map	7	q22.1	NCBI
HuRef	7	97,078,388 - 97,103,308 (+)	NCBI		HuRef
CHM1_1	7	102,648,727 - 102,673,618 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	104,390,254 - 104,414,903 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	102,075,694 - 102,100,576 (+)	NCBI

Armc10
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	21,851,004 - 21,867,697 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	21,850,811 - 21,867,692 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	21,646,006 - 21,662,699 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	21,645,813 - 21,662,694 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	21,151,802 - 21,168,410 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	21,157,808 - 21,174,416 (+)	NCBI		MGSCv36	mm8
Celera	5	18,609,447 - 18,630,713 (+)	NCBI		Celera
Cytogenetic Map	5	A3	NCBI
cM Map	5	9.97	NCBI

Armc10
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955410	8,203,080 - 8,216,196 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955410	8,203,127 - 8,217,421 (+)	NCBI	ChiLan1.0	ChiLan1.0

ARMC10
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	139,917,422 - 139,942,412 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	188,187,420 - 188,212,382 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	95,049,105 - 95,073,466 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	107,899,108 - 107,923,053 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	107,899,776 - 107,922,685 (+)	Ensembl	panpan1.1		panPan2

ARMC10
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	16,994,583 - 17,020,417 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	16,995,079 - 17,020,840 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	16,653,203 - 16,679,028 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	17,307,356 - 17,332,993 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	17,278,497 - 17,333,414 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	17,065,570 - 17,091,410 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	17,004,313 - 17,030,155 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	17,272,949 - 17,298,800 (-)	NCBI		UU_Cfam_GSD_1.0

Armc10
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	59,173,821 - 59,191,526 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936479	20,297,385 - 20,315,301 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936479	20,297,385 - 20,315,263 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ARMC10
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	103,179,503 - 103,262,014 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	103,179,754 - 103,210,658 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	113,785,951 - 113,816,855 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ARMC10
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	72,139,867 - 72,174,364 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	72,140,254 - 72,173,143 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666042	31,826,808 - 31,851,405 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Armc10
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624739	26,155,245 - 26,167,216 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624739	26,154,573 - 26,166,811 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Armc10
55 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	102
Count of miRNA genes:	73
Interacting mature miRNAs:	94
Transcripts:	ENSRNOT00000044020
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2302371	Stl22	Serum triglyceride level QTL 22	5.15		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	13080146	58080146	Rat
8552903	Pigfal2	Plasma insulin-like growth factor 1 level QTL 2	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	1	32668025	Rat
724557	Plsm1	Polydactyly-luxate syndrome (PLS) morphotypes QTL 1		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	4	1	28392287	Rat
9590100	Sffal4	Serum free fatty acids level QTL 4	7.36	0.05	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	4	1	32668025	Rat
8552906	Pigfal3	Plasma insulin-like growth factor 1 level QTL 3			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	11038706	56038706	Rat
1357341	Gluco5	Glucose level QTL 5	6.4		adipocyte free fatty acid secretion trait (VT:0010465)	absolute change in adipocyte free fatty acid secretion per unit volume (CMO:0001446)	4	1	34142783	Rat
1357343	Gluco4	Glucose level QTL 4		0.00002	adipocyte glucose uptake trait (VT:0004185)	adipocyte maximal glucose uptake to basal glucose uptake ratio (CMO:0000874)	4	1	34142783	Rat
8552782	Vie1	Viral induced encephalitis QTL 1	26.4		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	1	35396961	Rat
6478766	Anxrr47	Anxiety related response QTL 47		0.09637	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	11038706	56038706	Rat
631642	Stl2	Serum triglyceride level QTL 2	3.3		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5894575	57613242	Rat
6478769	Anxrr48	Anxiety related response QTL 48		0.02514	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	11038706	56038706	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	11706604	92690519	Rat
61333	Gluco16	Glucose level QTL 16	4.3	0.00001	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	1	31106810	Rat
61408	Scl23	Serum cholesterol level QTL 23		0.0005	blood HDL phospholipid amount (VT:0010504)	serum high density lipoprotein phospholipid level (CMO:0001567)	4	1	28392287	Rat
631209	Bw2	Body weight QTL2	4.2		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	1	45429897	Rat
8552803	Bw144	Body weight QTL 144	16		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	1	35396961	Rat
8694374	Bw155	Body weight QTL 155	3.39	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	4	11038706	56038706	Rat
8552801	Bw143	Body weight QTL 143	7.3		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	1	35396961	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5889999	148002343	Rat
9589046	Scfw2	Subcutaneous fat weight QTL 2	5.54	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	4	1	32668025	Rat
6478724	Anxrr35	Anxiety related response QTL 35		0.00449	defecation behavior trait (VT:0010462)	defecation measurement (CMO:0000997)	4	11038706	56038706	Rat
61351	Bp33	Blood pressure QTL 33		0.0018	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	1	28392287	Rat
61415	Eae11	Experimental allergic encephalomyelitis QTL 11	2.9		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	4	1	40471598	Rat
1641905	Colcr1	Colorectal carcinoma resistance QTL 1	4.3	0.0003	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	4	8428551	30449094	Rat
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5889999	50889999	Rat
8552809	Vie5	Viral induced encephalitis QTL 5	25.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	1	35396961	Rat
738021	Hcar13	Hepatocarcinoma resistance QTL 13	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	4	1	33538816	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	4	1	63900697	Rat
9590304	Scort17	Serum corticosterone level QTL 17	4.96	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	11038706	56038706	Rat
9589097	Slep11	Serum leptin concentration QTL 11	5.09	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	4	1	32668025	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
1300141	Bp178	Blood pressure QTL 178			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	10758701	40490708	Rat

Markers in Region

RH129373

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	13,399,167 - 13,399,325 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	10,005,010 - 10,005,167	NCBI	Rnor6.0
Rnor_5.0	4	10,006,169 - 10,006,326	UniSTS	Rnor5.0
RGSC_v3.4	4	8,848,472 - 8,848,629	UniSTS	RGSC3.4
Celera	4	8,977,847 - 8,978,004	UniSTS
RH 3.4 Map	4	41.4	UniSTS
Cytogenetic Map	4	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106576	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC130776	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079464	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC161913	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CN541016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DY320753	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000044020 ⟹ ENSRNOP00000042700

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	13,395,207 - 13,414,548 (-)	Ensembl
Rnor_6.0 Ensembl	4	10,004,848 - 10,020,022 (-)	Ensembl

RefSeq Acc Id:

NM_001106576 ⟹ NP_001100046

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	14,291,211 - 14,306,799 (-)	NCBI
mRatBN7.2	4	13,399,004 - 13,414,594 (-)	NCBI
Rnor_6.0	4	10,004,846 - 10,020,017 (-)	NCBI
Rnor_5.0	4	10,006,005 - 10,021,176 (-)	NCBI
RGSC_v3.4	4	8,848,308 - 8,862,081 (-)	RGD
Celera	4	8,977,683 - 8,991,195 (-)	RGD

Sequence:

show sequence

AGTGGGAGGGCTTCCGACCTCAGCAGGGCGGCTTCCGGAAGGCGGAGCTCCAACCCCATTTCCT
TTCTCTGGGCTGGTTCTGGCCCAGCTGCACCTGCGTGTGGCCCTGGCACCCCGGCTCCCTGCAG
CTCGGTGGCAGCAGTATGGGCGGCGCGCGGGACGTGGGCTGGGTGGCAGCCGGGCTAGTCCTGG
GCGCTGGCGCCTGCTACTGTATCTACCGGCTGACTCGGGGACCGCGGCGAGGCGGGCGCCGACT
GCGCCCTTCGCGGTCCGCAGAAGACCTAACGGAGGGCTCCTACGATGCTATCTTAAGTGCGGAG
CAGCTTGAGAAACTTCTGTACCTGCTGGAGTCAACCGACGACCCCATAATTACTGAGAAAGCCC
TGGTCACCTTGGGAAATAATGCAGCCTTTTCCACTAACCAAGCCATCATTCGTGAGTTGGGTGG
TATACCAATTGTCGGAAGCAAAATCAACTCCCTGAACCAAAGTATTAAAGAGAAAGCTTTAAAT
GCATTAAATAACCTGAGTGTGAACGTTGAAAATCAAACTAAGATAAAGATATACGTCCGTCAAG
TCTGTGAGGACGTCTTTGCTGATCCCCTGAACTCTGCGGTGCAGCTGGCTGCACTGAGGCTGCT
GACAAACATGACGGTCACCAATGACTACCAGCACCTGCTCAGCAACTACATCACCGGCCTGCTC
CACCTGCTACTTATCGGAAACGGAAGCACCAAGGTTCAGGTTTTGAAGCTGCTTTTGAATTTGT
CTGAGAATCCAGCCATGACAGAAGGACTACTGAGTGCCCAAGTGGACTCTTCATTCCTTTCCCT
GTACGATGGCCAAATGGCAAACGAGATTCTTCTTCGGGCTCTTACGCTGTTTCAGAATATAAAC
AACTGCCTCAGAGTGGAAGGCCGGTTAGCTAATCAGCTTCCTTTTGCTAAAGGGTCATTGTTTT
TCCTGTTGTATGGAGAAGAGTGTGCCCAGAAAATGAAGGCATTAGCTTGTCACCCTGATGTGGA
TGTGAAAGAGAAGGCTTTAGCAATAAAGCCGAAATTCTGATGGGTTGCTCCTGTTTTTATCAAA
GAGTCAGAGAGTGATGTGGAATTAAGTCAACACACGGGAACTTAGACCGTCCTTTAAAAGGATT
CTTTCAGCTGATGTGAGTTAAACCATAAAAGTGGGTGTGAGCAGCTCTAATCCAACATGATGTT
CAAACTGTTAGGTTTGGGAGTGGTTCAGATTTGGGGTTTGGGGATTGAATAGTCTGGAACCTTC
AGAGGATGTGAACCACTTCTGAGGCAAGCGTCGAGTTATGATGGTGGATGGATTGCCACGCTCT
AAGGGATTACTTTGAAGGCTTCTACTGCTATTCAATGAAGATGAGGGGCTGTGCTGAAGAGACT
CACTGAGGTATTTAATCGTATTCCTGACATGAAGTGAGTGGCCTTCCTCCACAGTCCTAACTCC
TGGGAGTGATTTGCGGTTGCTCAGTGTAAGGTGCTGATTGAAGACAGAAGTGCCACAGCCAGGG
CTGTGTGCCTCAAAGCAGTGAGTCCGGCAAGCTCGAGGCCACCCGCCACCCCCACCGCTCTGCT
TGCAAGTCCGAGTTCACCATAGACTCTGCCGGCATCATTTCTGATCAGTGAGACTGAACTTCCT
CCACCGGTGCACAGAGCGTTTCTAGAATGATCCGTATGTACAACTCCTGGGCGCGGGACTGGGA
CGTGGGTACGTGGATTCCTTTGTGTGCCTATTTCTACTGTTTGGATTTTTACTGAGCATAAACT
GTATAATTTTTTTTTAATAAAAAGGAAAATGGCAAGGTGGACATAATCTCTTCCCCTCATGGAC
GTGATTTTACCAAATTTCATCACATTTTACTTGACTAAAACTACAATACATGAAATGTGTTGAC
TTTTTTAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001100046	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI61913	(Get FASTA)	NCBI Sequence Viewer
	B1WBW4	(Get FASTA)	NCBI Sequence Viewer
	EDL99422	(Get FASTA)	NCBI Sequence Viewer
	EDL99423	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000042700
	ENSRNOP00000042700.3

RefSeq Acc Id:

NP_001100046 ⟸ NM_001106576

- UniProtKB:

B1WBW4 (UniProtKB/Swiss-Prot), A6K5B4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGGARDVGWVAAGLVLGAGACYCIYRLTRGPRRGGRRLRPSRSAEDLTEGSYDAILSAEQLEKL
LYLLESTDDPIITEKALVTLGNNAAFSTNQAIIRELGGIPIVGSKINSLNQSIKEKALNALNNL
SVNVENQTKIKIYVRQVCEDVFADPLNSAVQLAALRLLTNMTVTNDYQHLLSNYITGLLHLLLI
GNGSTKVQVLKLLLNLSENPAMTEGLLSAQVDSSFLSLYDGQMANEILLRALTLFQNINNCLRV
EGRLANQLPFAKGSLFFLLYGEECAQKMKALACHPDVDVKEKALAIKPKF

hide sequence

Ensembl Acc Id:

ENSRNOP00000042700 ⟸ ENSRNOT00000044020

Protein Domains

Armadillo repeat-containing

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B1WBW4-F1-model_v2	AlphaFold	B1WBW4	1-306	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692809

Promoter ID:

EPDNEW_R3333

Type:

initiation region

Name:

Armc10_1

Description:

armadillo repeat containing 10

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	10,019,955 - 10,020,015	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305915	AgrOrtholog
BioCyc Gene	G2FUF-45981	BioCyc
Ensembl Genes	ENSRNOG00000012785	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000044020	ENTREZGENE
	ENSRNOT00000044020.4	UniProtKB/Swiss-Prot
Gene3D-CATH	1.25.10.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7122237	IMAGE-MGC_LOAD
	IMAGE:8369555	IMAGE-MGC_LOAD
InterPro	ARM-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ARM-rpt_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ARM-type_fold	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Armcx_regulator	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:296758	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:187647	IMAGE-MGC_LOAD
	MGC:95019	IMAGE-MGC_LOAD
NCBI Gene	296758	ENTREZGENE
PANTHER	ARM_2 DOMAIN-CONTAINING PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ARMADILLO REPEAT CONTAINING PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Arm_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Armc10	PhenoGen
PROSITE	PROKAR_LIPOPROTEIN	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000012785	RatGTEx
Superfamily-SCOP	ARM repeat	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6K5B4	ENTREZGENE, UniProtKB/TrEMBL
	ARM10_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-07	Armc10	armadillo repeat containing 10	RGD1305915	similar to RIKEN cDNA 2810037C14	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1305915	similar to RIKEN cDNA 2810037C14	RGD1305915_predicted	similar to RIKEN cDNA 2810037C14 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1305915_predicted	similar to RIKEN cDNA 2810037C14 (predicted)	LOC296758_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC296758_predicted	similar to RIKEN cDNA 2810037C14 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar