Ecrg4 (ECRG4 augurin precursor) - Rat Genome Database

Name: Ecrg4
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ecrg4 (ECRG4 augurin precursor) Rattus norvegicus

Analyze

Symbol:

Ecrg4

Name:

ECRG4 augurin precursor

RGD ID:

1305645

Description:

Predicted to enable neuropeptide hormone activity. Involved in negative regulation of cell population proliferation and response to wounding. Located in extracellular space. Orthologous to human ECRG4 (ECRG4 augurin precursor); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',5,5'-tetrabromobisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

augurin; esophageal cancer related gene 4 protein; esophageal cancer-related gene 4 protein homolog; LOC363225; RGD1305645; similar to RIKEN cDNA 1500015O10

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ECRG4 (ECRG4 augurin precursor)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ecrg4 (ECRG4 augurin precursor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ecrg4 (ECRG4 augurin precursor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ECRG4 (ECRG4 augurin precursor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ECRG4 (ECRG4 augurin precursor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ECRG4 (ECRG4 augurin precursor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ECRG4 (ECRG4 augurin precursor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ecrg4 (ECRG4 augurin precursor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Ecrg4 (ECRG4 augurin precursor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ECRG4 (ECRG4 augurin precursor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ecrg4b (esophageal cancer related gene 4b)	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	ecrg4a (esophageal cancer related gene 4a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ecrg4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	9	45,992,954 - 46,012,605 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	45,992,954 - 46,012,595 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	54,505,053 - 54,524,710 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	59,627,854 - 59,647,511 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	57,908,081 - 57,927,739 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	50,526,811 - 50,548,056 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	50,526,811 - 50,548,046 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	50,191,450 - 50,212,695 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	42,931,051 - 42,950,605 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	42,932,613 - 42,952,019 (+)	NCBI
Celera	9	43,707,081 - 43,725,077 (+)	NCBI		Celera
Cytogenetic Map	9	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3,3',5,5'-tetrabromobisphenol A (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

7,12-dimethyltetraphene (EXP)

acrylamide (ISO)

arsenous acid (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

corticosterone (EXP)

Cuprizon (EXP)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP)

diuron (EXP)

dorsomorphin (ISO)

endosulfan (EXP)

entinostat (ISO)

fulvestrant (ISO)

genistein (ISO)

manganese(II) chloride (EXP)

methylmercury chloride (ISO)

N-methyl-4-phenylpyridinium (EXP)

nickel atom (ISO)

paracetamol (ISO)

rotenone (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

thimerosal (ISO)

valproic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anaphase-promoting complex-dependent catabolic process (IBA,ISO)

cellular senescence (IBA,ISO)

central nervous system development (IBA,ISS)

G1 to G0 transition (IBA,ISO)

negative regulation of cell population proliferation (IMP)

neuropeptide signaling pathway (ISO)

positive regulation of corticosterone secretion (ISO)

positive regulation of corticotropin secretion (ISO)

positive regulation of corticotropin-releasing hormone secretion (ISO)

regulation of cell population proliferation (IBA)

response to wounding (IMP)

vasopressin secretion (ISO)

Cellular Component

apical plasma membrane (IEA,ISO,ISS)

cytoplasm (IEA,ISO,ISS)

dense core granule (ISO,ISS)

extracellular region (IEA)

extracellular space (IBA,IDA,ISO,ISS)

Molecular Function

neuropeptide hormone activity (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Ecrg4 expression and its product augurin in the choroid plexus: impact on fetal brain development, cerebrospinal fluid homeostasis and neuroprogenitor cell response to CNS injury.	Gonzalez AM, etal., Fluids Barriers CNS. 2011 Jan 18;8(1):6. doi: 10.1186/2045-8118-8-6.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Identification of novel peptide hormones in the human proteome by hidden Markov model screening.	Mirabeau O, etal., Genome Res. 2007 Mar;17(3):320-7. Epub 2007 Feb 6.
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12060780	PMID:20233222	PMID:20404145	PMID:21935431	PMID:23626679	PMID:26150152

Genomics

Comparative Map Data

Ecrg4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	9	45,992,954 - 46,012,605 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	45,992,954 - 46,012,595 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	54,505,053 - 54,524,710 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	59,627,854 - 59,647,511 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	57,908,081 - 57,927,739 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	50,526,811 - 50,548,056 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	50,526,811 - 50,548,046 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	50,191,450 - 50,212,695 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	42,931,051 - 42,950,605 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	42,932,613 - 42,952,019 (+)	NCBI
Celera	9	43,707,081 - 43,725,077 (+)	NCBI		Celera
Cytogenetic Map	9	q22	NCBI

ECRG4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	106,063,241 - 106,078,155 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	106,063,246 - 106,078,155 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	106,682,144 - 106,694,611 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	106,048,545 - 106,061,040 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	2	100,882,549 - 100,895,038 (+)	NCBI		Celera
Cytogenetic Map	2	q12.2	NCBI
HuRef	2	100,451,504 - 100,464,588 (+)	NCBI		HuRef
CHM1_1	2	106,687,184 - 106,699,693 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	106,524,934 - 106,539,858 (+)	NCBI		T2T-CHM13v2.0

Ecrg4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	43,769,762 - 43,781,724 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	43,769,762 - 43,781,738 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	43,730,602 - 43,742,564 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	43,730,602 - 43,742,578 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	43,787,447 - 43,799,409 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	43,675,217 - 43,687,093 (+)	NCBI		MGSCv36	mm8
Celera	1	44,080,967 - 44,092,916 (+)	NCBI		Celera
Cytogenetic Map	1	C1.1	NCBI
cM Map	1	23.44	NCBI

Ecrg4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955470	10,645,750 - 10,659,388 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955470	10,646,585 - 10,655,311 (+)	NCBI	ChiLan1.0	ChiLan1.0

ECRG4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	2A	21,652,519 - 21,667,716 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	95,762,149 - 95,774,834 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	107,141,822 - 107,152,977 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	107,140,895 - 107,152,967 (+)	Ensembl	panpan1.1		panPan2

ECRG4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	37,423,183 - 37,432,961 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	37,423,183 - 37,433,322 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	37,347,657 - 37,357,428 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	38,272,970 - 38,282,714 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	38,272,977 - 38,282,878 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	38,005,101 - 38,014,873 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	38,281,847 - 38,291,645 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	38,476,371 - 38,486,148 (-)	NCBI		UU_Cfam_GSD_1.0

ECRG4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	48,960,429 - 48,971,511 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	48,960,413 - 48,971,878 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	51,051,816 - 51,062,808 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ECRG4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	9,686,930 - 9,698,708 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	9,687,043 - 9,699,049 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	177,409,300 - 177,421,000 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ecrg4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624749	9,947,188 - 9,956,983 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624749	9,947,366 - 9,956,876 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ecrg4
175 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	91
Count of miRNA genes:	74
Interacting mature miRNAs:	81
Transcripts:	ENSRNOT00000036990
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10054125	Srcrt7	Stress Responsive Cort QTL 7	3.33	0.0011	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	9	1	87073594	Rat
1331757	Cdexp1	CD45RC expression in CD8 T cells QTL 1	4.3		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	9	1024537	67509080	Rat
1354650	Despr5	Despair related QTL 5	4.01	0.0017	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	9	1254084	46254084	Rat
2303559	Gluco54	Glucose level QTL 54	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	1254084	46254084	Rat
631211	Bw4	Body weight QTL4	5.31		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	9	5109826	50109826	Rat
11353947	Bp392	Blood pressure QTL 392			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	7283252	52283252	Rat
9589133	Insul26	Insulin level QTL 26	17.96	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	9	8952560	53952560	Rat
7411609	Foco16	Food consumption QTL 16	25.6	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	8952560	53952560	Rat
631680	Cm11	Cardiac mass QTL 11	3.1	0.00089	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	9	20430519	65430519	Rat
70186	Niddm26	Non-insulin dependent diabetes mellitus QTL 26	3.87		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	9	22071169	86369743	Rat
631643	Bp120	Blood pressure QTL 120	3	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	22071200	67071200	Rat
1598823	Memor16	Memory QTL 16	1.9		exploratory behavior trait (VT:0010471)	difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678)	9	22133322	49968732	Rat
7207805	Bmd88	Bone mineral density QTL 88	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	9	23754024	58157242	Rat
1300180	Bw14	Body weight QTL 14	3.776		body mass (VT:0001259)	body weight (CMO:0000012)	9	23754024	61381613	Rat
7207814	Bmd91	Bone mineral density QTL 91	3.5		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	9	23754144	83851531	Rat
70218	Cm28	Cardiac mass QTL 28	8.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	25268044	79271759	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	25268044	114175309	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	25661188	100929786	Rat
1641894	Alcrsp12	Alcohol response QTL 12			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	27468639	72468639	Rat
7411656	Foco26	Food consumption QTL 26	9.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	32535505	77535505	Rat
7411571	Bw138	Body weight QTL 138	14.3	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	9	32535505	77535505	Rat
1598834	Memor11	Memory QTL 11	2.5		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	9	36962359	77814038	Rat
8662828	Vetf6	Vascular elastic tissue fragility QTL 6	3.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	9	36962359	92058970	Rat
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	36962359	95410867	Rat
6903941	Pur31	Proteinuria QTL 31		0.036	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	9	40194188	85194188	Rat
11353949	Bp393	Blood pressure QTL 393			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	40194188	85194188	Rat
61352	Bp34	Blood pressure QTL 34	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	42495343	79271511	Rat
10058949	Gmadr5	Adrenal mass QTL 5	2	0.014	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	9	42791513	87976209	Rat
11353951	Bp394	Blood pressure QTL 394			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	44649921	89649921	Rat
12879506	Pur33	Proteinuria QTL 33			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	44649921	89649921	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	1	16			10		6	9	9	35	29		6
Low	2	27	49	34	8	34	2	2	65		12	11	2
Below cutoff			8	7	1	7

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001271051	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BG662789	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473965	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000214	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000036990 ⟹ ENSRNOP00000030526

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	45,992,954 - 46,012,595 (+)	Ensembl
Rnor_6.0 Ensembl	9	50,526,811 - 50,548,046 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000095751 ⟹ ENSRNOP00000096944

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	45,998,844 - 46,012,595 (+)	Ensembl

RefSeq Acc Id:

NM_001271051 ⟹ NP_001257980

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	9	45,992,954 - 46,012,605 (+)	NCBI
Rnor_6.0	9	50,526,811 - 50,548,056 (+)	NCBI
Rnor_5.0	9	50,191,450 - 50,212,695 (+)	NCBI
Celera	9	43,707,081 - 43,725,077 (+)	NCBI

Sequence:

show sequence

GTGAGCCAGCATTCTCTGTCCAGCCTGGTTGGGCTGTGCCTGGCATCCGTCTTGCCCTCTCCCC
TTTAGCCACGCGGCTCCTCTCAGTGATTTGCAGCAGACCCGCAGGGCAGTGTGCCTCGGTGGCA
TTGAATTGAAGCTTGGCCCACGGCCTGGCCTTCTGGCTAGTTGCCCGCCCGGTGGGTCCCGCCC
CGAGCAAAGACACCCGAGCTCTCTCGCGCCTGCCTCTCTGAGCCTGGGTCCCCGCTCCAGTCAT
CCCTCCAGCCACTTTGCAGCACACTGCCGCCATGGGCACCTCCTCTGCTCGGCCTGCAGTCCTG
GCCCTAGCTGGGCTCGCGCTGCTCCTTCTGCTGTGTCTGGGTCCAGGTGACGTAAGTGGAAACA
AACTCAAGAAGATGCTTCAGAAACGAGAAGGACCTGTTCCATCAAAGACGAACGTAGCTGTTTC
TGAGCACACAGCAAAGGAATTCCTAGGTGGCCTGAAGCGTGCCAAACGACAGCTGTGGGACCGT
ACACGACCTGAGGTACAGCAGTGGTACCAGCAGTTCCTGTACATGGGCTTCGATGAGGCGAAAT
TTGAAGATGATGTCAACTATTGGCTAAACAGAAACCAAAATGGCCATGACTACTATGGTGACTA
CTACCAGCGTCACTATGATGAAGATGCGGCCATTGGTCCCCGCAGCCGGGAAGGCTTTAGGCAC
GGAGCCAGTGTCAACTATGATGACTATTAAAGCTCCCTGAGGTGCCACAGAGCCTGTGCCTTGC
TTCAGCAGACCTTCCCCACTGTAACACGTGGACATCAGGCTAAAGGAAAGAATATCAGTGCCTT
TTATATTTCATGCATGCACTTAACAATACGTCTCCCTTAAAAATAGAAATAAAAGCATTTTTTT
AAAAAGAGAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001257980	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	D4A540	(Get FASTA)	NCBI Sequence Viewer
	EDL99143	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001257980 ⟸ NM_001271051
- Peptide Label:	precursor
- UniProtKB:	D4A540 (UniProtKB/Swiss-Prot), A0A8I6AR41 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGTSSARPAVLALAGLALLLLLCLGPGDVSGNKLKKMLQKREGPVPSKTNVAVSEHTAKEFLGG LKRAKRQLWDRTRPEVQQWYQQFLYMGFDEAKFEDDVNYWLNRNQNGHDYYGDYYQRHYDEDAA IGPRSREGFRHGASVNYDDY hide sequence

RefSeq Acc Id:

ENSRNOP00000030526 ⟸ ENSRNOT00000036990

RefSeq Acc Id:

ENSRNOP00000096944 ⟸ ENSRNOT00000095751

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A540-F1-model_v2	AlphaFold	D4A540	1-148	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305645	AgrOrtholog
BioCyc Gene	G2FUF-27665	BioCyc
Ensembl Genes	ENSRNOG00000023576	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000030526	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOP00000096944.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000036990	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000095751.1	UniProtKB/TrEMBL
InterPro	Augurin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:363225	UniProtKB/Swiss-Prot
NCBI Gene	363225	ENTREZGENE
PANTHER	AUGURIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR31613	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Augurin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ecrg4	PhenoGen
UniProt	A0A8I6AR41	ENTREZGENE, UniProtKB/TrEMBL
	AUGN_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-08-05	Ecrg4	ECRG4 augurin precursor	RGD1305645	similar to RIKEN cDNA 1500015O10	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1305645	similar to RIKEN cDNA 1500015O10	RGD1305645_predicted	similar to RIKEN cDNA 1500015O10 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-20	RGD1305645_predicted	similar to RIKEN cDNA 1500015O10 (predicted)	LOC363225_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC363225_predicted	similar to RIKEN cDNA 1500015O10 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message