Eif6 (eukaryotic translation initiation factor 6)

Advanced Search (OLGA)

Gene: Eif6 (eukaryotic translation initiation factor 6) Rattus norvegicus

Analyze

Symbol:

Eif6

Name:

eukaryotic translation initiation factor 6

RGD ID:

1305373

Description:

Predicted to enable ribosomal large subunit binding activity. Predicted to be involved in several processes, including regulation of glycolytic process; regulation of translation; and ribosome biogenesis. Predicted to be located in cytoplasm; lamin filament; and nucleoplasm. Predicted to be part of preribosome, large subunit precursor. Predicted to be active in cytosol; nucleolus; and synapse. Orthologous to human EIF6 (eukaryotic translation initiation factor 6); PARTICIPATES IN ribosome biogenesis pathway; INTERACTS WITH 2,4-dinitrotoluene; 2,6-dinitrotoluene; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

eIF-6; integrin beta 4 binding protein; Itgb4bp; LOC305506; MGC124669

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	EIF6 (eukaryotic translation initiation factor 6)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Eif6 (eukaryotic translation initiation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Eif6 (eukaryotic translation initiation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	EIF6 (eukaryotic translation initiation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	EIF6 (eukaryotic translation initiation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Eif6 (eukaryotic translation initiation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	EIF6 (eukaryotic translation initiation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	EIF6 (eukaryotic translation initiation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	EIF6 (eukaryotic translation initiation factor 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Eif6 (eukaryotic translation initiation factor 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	eif6 (eukaryotic translation initiation factor 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	TIF6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	eIF6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	eif-6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	eif6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Related Pseudogenes:

Eif6-ps1

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	164,785,162 - 164,791,410 (-)	NCBI		GRCr8
mRatBN7.2	3	144,325,038 - 144,331,396 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	144,325,036 - 144,331,401 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	148,190,428 - 148,196,661 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	156,807,695 - 156,813,928 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	154,547,215 - 154,553,448 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	151,356,867 - 151,363,201 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	151,356,868 - 151,363,115 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	157,722,078 - 157,728,394 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.1	14	87,483,901 - 87,491,947 (-)	NCBI
Celera	3	143,049,279 - 143,055,527 (-)	NCBI		Celera
Cytogenetic Map	3	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

bladder exstrophy-epispadias-cloacal exstrophy complex (ISO)

Breast Neoplasms (ISO)

glutathione synthetase deficiency (ISO)

human immunodeficiency virus infectious disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-bromohexadecanoic acid (ISO)

2-hydroxypropanoic acid (ISO)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (ISO)

4,4'-sulfonyldiphenol (ISO)

actinomycin D (ISO)

antimycin A (ISO)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

benzatropine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

butan-1-ol (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

caffeine (ISO)

carbon nanotube (ISO)

carmustine (ISO)

chloropicrin (ISO)

chlorpyrifos (ISO)

clobetasol (ISO)

clofibrate (ISO)

clozapine (ISO)

copper atom (ISO)

copper(0) (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dioxygen (ISO)

diquat (ISO)

diuron (EXP)

elemental selenium (ISO)

enzyme inhibitor (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fipronil (EXP)

flutamide (EXP)

FR900359 (ISO)

fumonisin B1 (ISO)

gentamycin (EXP)

glafenine (EXP)

indometacin (ISO)

ivermectin (ISO)

leflunomide (ISO)

N-(6-acetamidohexyl)acetamide (ISO)

N-methyl-4-phenylpyridinium (ISO)

nefazodone (EXP)

Nutlin-3 (ISO)

ozone (ISO)

paracetamol (ISO)

paraquat (EXP)

perfluorononanoic acid (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (EXP)

selenium atom (ISO)

silicon dioxide (ISO)

sodium dichromate (EXP)

T-2 toxin (EXP)

tamoxifen (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

thiram (ISO)

triphenyl phosphate (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

assembly of large subunit precursor of preribosome (IBA)

biological_process (ND)

cytosolic ribosome assembly (IEA,ISO)

maturation of 5.8S rRNA (IBA)

maturation of LSU-rRNA (IBA)

miRNA-mediated gene silencing by inhibition of translation (ISO,ISS)

miRNA-mediated post-transcriptional gene silencing (ISO,ISS)

positive regulation of translation (ISO,ISS)

regulation of fatty acid biosynthetic process (ISO,ISS)

regulation of glycolytic process (ISO,ISS)

regulation of megakaryocyte differentiation (ISO,ISS)

regulation of reactive oxygen species metabolic process (ISO,ISS)

response to insulin (ISO,ISS)

ribosomal large subunit biogenesis (IEA)

ribosomal subunit export from nucleus (IBA,IEA)

translational initiation (IEA)

Cellular Component

cytoplasm (IEA,ISO)

cytosol (IBA)

intermediate filament (ISO)

lamin filament (ISO)

nucleolus (IBA,IEA)

nucleoplasm (ISO)

nucleus (ISO)

preribosome, large subunit precursor (IBA)

synapse (ISO)

Molecular Function

protein binding (ISO)

ribosomal large subunit binding (IBA,IEA)

ribosome binding (ISO)

translation initiation factor activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

ribosome biogenesis pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Eukaryotic initiation factor 6 mediates a continuum between 60S ribosome biogenesis and translation.	Miluzio A, etal., EMBO Rep. 2009 May;10(5):459-65. doi: 10.1038/embor.2009.70. Epub 2009 Apr 17.
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:9374518	PMID:12426392	PMID:12477932	PMID:17507929	PMID:19056867	PMID:21536732	PMID:22082260	PMID:23376485	PMID:23533145	PMID:26383020	PMID:26391622	PMID:29128355

Genomics

Comparative Map Data

Eif6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	164,785,162 - 164,791,410 (-)	NCBI		GRCr8
mRatBN7.2	3	144,325,038 - 144,331,396 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	144,325,036 - 144,331,401 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	148,190,428 - 148,196,661 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	156,807,695 - 156,813,928 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	154,547,215 - 154,553,448 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	151,356,867 - 151,363,201 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	151,356,868 - 151,363,115 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	157,722,078 - 157,728,394 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.1	14	87,483,901 - 87,491,947 (-)	NCBI
Celera	3	143,049,279 - 143,055,527 (-)	NCBI		Celera
Cytogenetic Map	3	q42	NCBI

EIF6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	35,278,906 - 35,284,772 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	35,278,907 - 35,284,985 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	33,866,709 - 33,872,575 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	33,330,139 - 33,336,008 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	33,330,138 - 33,335,920	NCBI
Celera	20	30,615,330 - 30,621,199 (-)	NCBI		Celera
Cytogenetic Map	20	q11.22	NCBI
HuRef	20	30,644,132 - 30,650,042 (-)	NCBI		HuRef
CHM1_1	20	33,767,787 - 33,773,697 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	20	36,999,768 - 37,005,633 (-)	NCBI		T2T-CHM13v2.0

Eif6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	155,661,757 - 155,668,845 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	155,661,752 - 155,668,845 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	155,819,837 - 155,826,925 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	155,819,832 - 155,826,925 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	155,645,573 - 155,652,661 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	155,511,278 - 155,518,366 (-)	NCBI		MGSCv36	mm8
Celera	2	161,752,364 - 161,759,336 (-)	NCBI		Celera
Cytogenetic Map	2	H1	NCBI
cM Map	2	77.26	NCBI

Eif6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004956210	21 - 9,816 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004956210	226 - 6,819 (+)	NCBI	ChiLan1.0	ChiLan1.0

EIF6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	41,013,352 - 41,019,306 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	41,006,444 - 41,012,410 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	31,608,264 - 31,614,225 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	32,731,097 - 32,737,136 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	32,731,097 - 32,737,136 (-)	Ensembl	panpan1.1		panPan2

EIF6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	24,259,623 - 24,266,453 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	24,259,620 - 24,266,255 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	23,905,521 - 23,912,185 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	24,951,802 - 24,958,477 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	24,951,799 - 24,958,930 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	24,238,654 - 24,245,318 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	24,333,669 - 24,340,340 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	24,772,767 - 24,779,438 (-)	NCBI		UU_Cfam_GSD_1.0

Eif6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	173,271,873 - 173,278,473 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936561	5,471,102 - 5,477,813 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936561	5,471,113 - 5,477,679 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EIF6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	38,638,298 - 38,643,973 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	38,638,295 - 38,643,918 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

EIF6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	56,185,419 - 56,190,993 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	56,184,679 - 56,191,012 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666087	2,336,092 - 2,341,826 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Eif6
25 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	166
Count of miRNA genes:	110
Interacting mature miRNAs:	128
Transcripts:	ENSRNOT00000073492
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
1298068	Bp167	Blood pressure QTL 167		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141074471	169034231	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
2298477	Eau4	Experimental allergic uveoretinitis QTL 4		0.0011	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	3	137398739	169034231	Rat
61335	Bp20	Blood pressure QTL 20	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141339236	155617360	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1331726	Bp208	Blood pressure QTL 208	3.129		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	141339013	162184794	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	121056165	145956249	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
5686842	Rf59	Renal function QTL 59			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	3	140069424	146976080	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
8552952	Pigfal13	Plasma insulin-like growth factor 1 level QTL 13			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	138799500	169034231	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat

Markers in Region

RH130292

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	144,325,074 - 144,325,231 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	151,356,904 - 151,357,060	NCBI	Rnor6.0
Rnor_5.0	3	157,722,115 - 157,722,271	UniSTS	Rnor5.0
Celera	3	143,049,316 - 143,049,472	UniSTS
RH 3.4 Map	14	577.69	UniSTS
Cytogenetic Map	3	q42	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

alimentary part of gastrointestinal system

circulatory system

endocrine system

exocrine system

hemolymphoid system

hepatobiliary system

integumental system

musculoskeletal system

nervous system

renal system

reproductive system

respiratory system

appendage

High

Medium

141

227

147

250

115

145

Low

Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001037352	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC105764	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474050	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220694	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220773	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225904	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226630	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000073492 ⟹ ENSRNOP00000066257

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	144,325,036 - 144,331,401 (-)	Ensembl
Rnor_6.0 Ensembl	3	151,356,868 - 151,363,115 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000078688 ⟹ ENSRNOP00000071658

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	144,327,982 - 144,331,401 (-)	Ensembl
Rnor_6.0 Ensembl	3	151,359,482 - 151,362,890 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116245 ⟹ ENSRNOP00000080957

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	144,327,310 - 144,331,401 (-)	Ensembl

RefSeq Acc Id:

NM_001037352 ⟹ NP_001032429

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	164,785,162 - 164,791,410 (-)	NCBI
mRatBN7.2	3	144,325,038 - 144,331,286 (-)	NCBI
Rnor_6.0	3	151,356,867 - 151,363,115 (-)	NCBI
Rnor_5.0	3	157,722,078 - 157,728,394 (-)	NCBI
Celera	3	143,049,279 - 143,055,527 (-)	RGD

Sequence:

show sequence

TGGAGTCGTTTGGTGAACTGGTGGGGCTCTGGGAGGCAAAGGTCAGTTCCGGGCCGTAGGGCGG
GAGGCTTTGGGGCAAGAGAGTCAGGAAGGATCCCGCGGACGAGACCCGGGATCTGAGGGGTTTG
AGAGGGCGGGGCTTGAGGAAGCGAAGCTGGTTGACCCGGCTCCTGAGTGGATCTGTCGGCCCAG
AACCCGCAGTCGTGCAGCCCCCAGGTTTCTTTCATGGCGGTCAGAGCGTCGTTCGAGAACAACT
GTGAGGTCGGTTGTTTTGCCAAACTCACTAACACCTACTGCCTGGTGGCCATCGGAGGGTCAGA
GAACTTCTACAGTGTGTTCGAGGGCGAGCTCTCCGATACCATTCCTGTAGTGCACGCATCCATC
GCCGGCTGCCGAATCATCGGGCGCATGTGTGTGGGGAACAGGCATGGGCTGCTGGTACCCAACA
ACACCACCGACCAGGAGCTGCAGCATATCCGCAACAGCCTTCCGGATTCAGTGCAGATACGGCG
GGTAGAGGAGCGGCTCTCAGCCCTTGGCAATGTCACCACCTGCAATGACTATGTGGCCTTGGTC
CACCCAGACTTGGATAGGGAGACAGAAGAAATCCTGGCTGATGTGCTCAAGGTGGAAGTCTTCA
GGCAGACGGTTGCTGACCAGGTGTTAGTTGGAAGCTACTGTGTCTTCAGTAATCAAGGAGGTCT
GGTGCACCCTAAAACTTCGATCGAGGATCAGGATGAGCTGTCCTCCCTTCTTCAGGTTCCCCTT
GTGGCAGGCACTGTGAACCGAGGGAGCGAGGTGATTGCTGCCGGGATGGTAGTGAATGATTGGT
GTGCTTTCTGTGGCCTGGACACGACCAGCACAGAGCTGTCAGTGGTGGAGAGTGTCTTCAAGCT
GAATGAAGCCAAACCTAGCACCATTGCCACCAGCATGCGGGACTCCCTCATTGACAGCCTCACA
TGAGTCACCTTCCGTGCTGTCGTGTGGGCTCCTGCCTCTGGACTTTGGCTCGTTTTCCACGCCT
GAGTTAGTCTGTACCAGATGCTGTCAGTGGGGCGTGGCAGAGCTCACCAGAGCTGAATTGTTTG
CCCAACCCTTCACCTGTGCCATCTCAACTATTGTTACCGAAAAGCCTGCCGCGTCACGCTGGCT
TCAGTTCCTGTGGCTCTTGGATGGAAGTTCTGCTATCTTGTGCCCCACCCCATTAAAGGACTGC
CTCCCACCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001032429	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI05765	(Get FASTA)	NCBI Sequence Viewer
	EDL85894	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000066257.1
	ENSRNOP00000071658.2
	ENSRNOP00000080957.1
	ENSRNOP00055034509
	ENSRNOP00060041089
	ENSRNOP00065040194
GenBank Protein	Q3KRD8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001032429 ⟸ NM_001037352

- UniProtKB:

Q3KRD8 (UniProtKB/Swiss-Prot), A0A8I5ZQX8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAVRASFENNCEVGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCV
GNRHGLLVPNNTTDQELQHIRNSLPDSVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEI
LADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEV
IAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAKPSTIATSMRDSLIDSLT

hide sequence

Ensembl Acc Id:

ENSRNOP00000066257 ⟸ ENSRNOT00000073492

Ensembl Acc Id:

ENSRNOP00000071658 ⟸ ENSRNOT00000078688

Ensembl Acc Id:

ENSRNOP00000080957 ⟸ ENSRNOT00000116245

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q3KRD8-F1-model_v2	AlphaFold	Q3KRD8	1-245	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692589

Promoter ID:

EPDNEW_R3114

Type:

multiple initiation site

Name:

Eif6_1

Description:

eukaryotic translation initiation factor 6

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	151,363,140 - 151,363,200	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305373	AgrOrtholog
BioCyc Gene	G2FUF-47116	BioCyc
Ensembl Genes	ENSRNOG00000049497	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055024559	UniProtKB/Swiss-Prot
	ENSRNOG00060028303	UniProtKB/Swiss-Prot
	ENSRNOG00065028436	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000073492.3	UniProtKB/Swiss-Prot
	ENSRNOT00000078688.2	UniProtKB/TrEMBL
	ENSRNOT00000116245.1	UniProtKB/TrEMBL
	ENSRNOT00055042277	UniProtKB/Swiss-Prot
	ENSRNOT00060049230	UniProtKB/Swiss-Prot
	ENSRNOT00065049009	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7929717	IMAGE-MGC_LOAD
InterPro	eIF6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:305506	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:124669	IMAGE-MGC_LOAD
NCBI Gene	305506	ENTREZGENE
PANTHER	EUKARYOTIC TRANSLATION INITIATION FACTOR 6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10784	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	eIF-6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Eif6	PhenoGen
PIRSF	IF-6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000049497	RatGTEx
	ENSRNOG00055024559	RatGTEx
	ENSRNOG00060028303	RatGTEx
	ENSRNOG00065028436	RatGTEx
SMART	eIF6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Pentein	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2K110_RAT	UniProtKB/TrEMBL
	A0A8I5ZQX8	ENTREZGENE, UniProtKB/TrEMBL
	IF6_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-04	Eif6	eukaryotic translation initiation factor 6	Itgb4bp	integrin beta 4 binding protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Itgb4bp	integrin beta 4 binding protein	Itgb4bp_predicted	integrin beta 4 binding protein (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Itgb4bp_predicted	integrin beta 4 binding protein (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)