Fto (FTO, alpha-ketoglutarate dependent dioxygenase)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Fto (FTO, alpha-ketoglutarate dependent dioxygenase) Rattus norvegicus

Analyze

Symbol:

Fto

Name:

FTO, alpha-ketoglutarate dependent dioxygenase

RGD ID:

1305121

Description:

Predicted to enable 2-oxoglutarate-dependent dioxygenase activity and ferrous iron binding activity. Predicted to be involved in several processes, including mRNA destabilization; nucleic acid metabolic process; and regulation of respiratory system process. Predicted to be located in cytosol; nuclear speck; and plasma membrane. Human ortholog(s) of this gene implicated in obesity. Orthologous to human FTO (FTO alpha-ketoglutarate dependent dioxygenase); INTERACTS WITH acetamide; aconitine; arsenite(3-).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

alpha-ketoglutarate-dependent dioxygenase FTO; fat mass and obesity associated; fat mass and obesity-associated protein; LOC291905; m6A(m)-demethylase FTO; mRNA (2'-O-methyladenosine-N(6)-)-demethylase FTO; mRNA N(6)-methyladenosine demethylase FTO; RGD1305121; similar to fatso; similar to FTO; tRNA N1-methyl adenine demethylase FTO; U6 small nuclear RNA (2'-O-methyladenosine-N(6)-)-demethylase FTO; U6 small nuclear RNA N(6)-methyladenosine-demethylase FTO

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	19	15,284,898 - 15,692,142 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	15,349,696 - 15,692,083 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	17,040,780 - 17,381,004 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	19	22,235,585 - 22,575,539 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	19	25,181,005 - 25,521,665 (-)	NCBI	Rnor_WKY
Rnor_6.0	19	16,774,549 - 17,115,098 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	16,772,744 - 17,115,113 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	27,803,098 - 28,182,268 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	16,514,746 - 16,858,800 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	16,517,774 - 16,845,431 (-)	NCBI
Celera	19	15,258,617 - 15,598,740 (-)	NCBI		Celera
Cytogenetic Map	19	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Body Weight (ISO)

Breast Neoplasms (ISO)

genetic disease (ISO)

Growth Retardation, Developmental Delay, Coarse Facies, and Early Death (ISO)

Joubert syndrome (ISO)

Joubert syndrome 1 (ISO)

Meckel syndrome (ISO)

Meckel syndrome 1 (ISO)

melanoma (ISO)

nephronophthisis (ISO)

nephronophthisis 1 (ISO)

non-alcoholic fatty liver disease (ISO)

obesity (ISO)

Pediatric Obesity (ISO)

type 2 diabetes mellitus (ISO)

Weight Gain (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

acetamide (EXP)

aconitine (EXP)

acrolein (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (EXP,ISO)

Benoxacor (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

cisplatin (ISO)

coumarin (ISO)

dexamethasone (ISO)

dicrotophos (ISO)

dihydroartemisinin (ISO)

enzyme inhibitor (ISO)

epoxiconazole (ISO)

ethanol (ISO)

formaldehyde (ISO)

fumonisin B1 (ISO)

indometacin (ISO)

irinotecan (ISO)

isoflurane (ISO)

ivermectin (ISO)

lead(0) (ISO)

lead(2+) (ISO)

methapyrilene (ISO)

N-acetyl-L-cysteine (ISO)

nafamostat (ISO)

O-methyleugenol (ISO)

oxaliplatin (EXP)

ozone (ISO)

pentanal (ISO)

sevoflurane (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

Soman (EXP)

temozolomide (ISO)

thioacetamide (EXP)

topotecan (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adipose tissue development (IEA,ISO)

DNA dealkylation involved in DNA repair (IEA,ISO,ISS)

DNA demethylation (ISO)

mRNA destabilization (IEA,ISO,ISS)

oxidative demethylation (ISO)

oxidative single-stranded DNA demethylation (IBA,IEA,ISO,ISS)

oxidative single-stranded RNA demethylation (IBA,IEA,ISO,ISS)

regulation of brown fat cell differentiation (IEA,ISO)

regulation of lipid storage (IEA,ISO)

regulation of multicellular organism growth (IEA,ISO)

regulation of respiratory system process (IEA,ISO)

regulation of white fat cell proliferation (IEA,ISO)

RNA repair (IEA,ISO)

temperature homeostasis (IEA,ISO)

Cellular Component

cellular_component (ND)

cytoplasm (ISO)

cytoplasm (ISS)

cytosol (IEA)

cytosol (ISO)

intracellular membrane-bounded organelle (ISO)

nuclear speck (IEA,ISO,ISS)

nucleus (ISO)

nucleus (ISO,ISS)

plasma membrane (IEA)

plasma membrane (ISO)

Molecular Function

DNA-N1-methyladenine dioxygenase activity (IBA,IEA,ISO,ISS)

ferrous iron binding (IBA,IEA,ISO,ISS)

molecular_function (ND)

mRNA N6-methyladenosine dioxygenase activity (IBA,IEA,ISO,ISS)

oxidative DNA demethylase activity (IBA,IEA,ISO,ISS)

oxidative RNA demethylase activity (ISO,ISS)

protein binding (ISO)

tRNA demethylase activity (IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:17991826	PMID:18218688	PMID:18775698	PMID:19234441	PMID:20098739	PMID:20376003	PMID:21267512	PMID:21779089	PMID:21980407	PMID:22002720	PMID:23329013
PMID:23671692	PMID:24019958	PMID:25452335	PMID:26287746	PMID:26457839	PMID:26458103	PMID:28002401	PMID:28179100	PMID:28914170	PMID:29890211	PMID:30197295	PMID:34310344
PMID:35462195	PMID:35803057	PMID:36327034	PMID:36538851

Genomics

Comparative Map Data

Fto
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	19	15,284,898 - 15,692,142 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	15,349,696 - 15,692,083 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	17,040,780 - 17,381,004 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	19	22,235,585 - 22,575,539 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	19	25,181,005 - 25,521,665 (-)	NCBI	Rnor_WKY
Rnor_6.0	19	16,774,549 - 17,115,098 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	16,772,744 - 17,115,113 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	27,803,098 - 28,182,268 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	16,514,746 - 16,858,800 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	16,517,774 - 16,845,431 (-)	NCBI
Celera	19	15,258,617 - 15,598,740 (-)	NCBI		Celera
Cytogenetic Map	19	p11	NCBI

FTO
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	53,703,963 - 54,121,941 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	16	53,701,692 - 54,158,512 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	53,737,875 - 54,155,853 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	52,295,376 - 52,705,882 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	16	38,252,466 - 38,662,847 (+)	NCBI		Celera
Cytogenetic Map	16	q12.2	NCBI
HuRef	16	39,624,702 - 40,035,200 (+)	NCBI		HuRef
CHM1_1	16	55,145,011 - 55,555,415 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	59,501,796 - 59,919,950 (+)	NCBI		T2T-CHM13v2.0

Fto
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	92,039,995 - 92,395,061 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	92,040,153 - 92,395,067 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	91,313,367 - 91,668,433 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	91,313,525 - 91,668,439 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	93,837,424 - 94,192,332 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	94,203,644 - 94,558,535 (+)	NCBI		MGSCv36	mm8
Celera	8	95,629,636 - 95,973,782 (+)	NCBI		Celera
Cytogenetic Map	8	C5	NCBI
cM Map	8	44.34	NCBI

Fto
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955433	11,424,176 - 11,813,771 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955433	11,424,069 - 11,834,955 (+)	NCBI	ChiLan1.0	ChiLan1.0

FTO
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	16	53,023,203 - 53,451,708 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	53,023,425 - 53,490,231 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	16	33,939,300 - 34,343,419 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

FTO
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	61,699,864 - 62,080,199 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	61,652,236 - 62,080,059 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	58,284,508 - 58,713,282 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	62,193,054 - 62,621,914 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	62,226,376 - 62,622,690 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	59,017,676 - 59,445,579 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	60,044,508 - 60,472,356 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	60,919,844 - 61,348,533 (-)	NCBI		UU_Cfam_GSD_1.0

Fto
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	52,899,665 - 53,267,356 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	6,321,711 - 6,689,588 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936475	6,321,725 - 6,689,410 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FTO
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	31,174,569 - 31,564,718 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	31,177,112 - 31,564,674 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

FTO
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	39,487,304 - 39,900,238 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	39,487,418 - 39,725,747 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	36,477,673 - 36,894,149 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fto
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624757	2,675,671 - 3,080,480 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624757	2,675,810 - 3,081,751 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Fto
1746 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	526
Count of miRNA genes:	235
Interacting mature miRNAs:	302
Transcripts:	ENSRNOT00000015718
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411590	Foco7	Food consumption QTL 7	6.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	19	1	24688055	Rat
10054132	Srcrt9	Stress Responsive Cort QTL 9	2.87	0.0017	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	27355345	Rat
631678	Cm9	Cardiac mass QTL 9	4.27	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	19	1	28982497	Rat
631681	Cm12	Cardiac mass QTL 12	3.33	0.00053	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	19	1	28982497	Rat
1549847	Bss8	Bone structure and strength QTL 8	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	19	1	31963836	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	1	36824771	Rat
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	1	36824771	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	36824771	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	1	36824771	Rat
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	7457249	42983518	Rat
724565	Tcas5	Tongue tumor susceptibility QTL 5	10.04		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	19	9977753	39654489	Rat
631840	Niddm38	Non-insulin dependent diabetes mellitus QTL 38	3.86		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	19	10323180	23069265	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10827970	43544039	Rat
61407	Scl12	Serum cholesterol level QTL 12		0.001	blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	19	13926401	30303727	Rat
1558656	Prcs1	Prostate cancer susceptibility QTL 1	5		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	19	15114598	34521833	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	15605023	46559041	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat

Markers in Region

D19Mit4

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	15,605,023 - 15,605,265 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	17,028,003 - 17,028,244	NCBI	Rnor6.0
Rnor_5.0	19	28,094,796 - 28,095,037	UniSTS	Rnor5.0
RGSC_v3.4	19	16,770,857 - 16,771,099	RGD	RGSC3.4
RGSC_v3.4	19	16,770,858 - 16,771,099	UniSTS	RGSC3.4
RGSC_v3.1	19	16,775,647 - 16,775,997	RGD
Celera	19	15,511,806 - 15,512,046	UniSTS
RH 2.0 Map	19	284.5	RGD
Cytogenetic Map	19	p11	UniSTS

D19Got6

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	15,353,235 - 15,353,448 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	16,776,583 - 16,776,799	NCBI	Rnor6.0
Rnor_5.0	19	27,844,089 - 27,844,305	UniSTS	Rnor5.0
RGSC_v3.4	19	16,516,779 - 16,516,992	RGD	RGSC3.4
RGSC_v3.4	19	16,516,780 - 16,516,992	UniSTS	RGSC3.4
RGSC_v3.1	19	16,521,605 - 16,521,818	RGD
Celera	19	15,260,651 - 15,260,863	UniSTS
RH 2.0 Map	19	266.6	RGD
Cytogenetic Map	19	p11	UniSTS

RH134051

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	15,351,152 - 15,351,341 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	16,774,500 - 16,774,688	NCBI	Rnor6.0
Rnor_5.0	19	27,842,006 - 27,842,194	UniSTS	Rnor5.0
RGSC_v3.4	19	16,514,697 - 16,514,885	UniSTS	RGSC3.4
Celera	19	15,258,568 - 15,258,756	UniSTS
Cytogenetic Map	19	p11	UniSTS

RH129525

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	15,349,421 - 15,349,620 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	16,772,769 - 16,772,967	NCBI	Rnor6.0
Rnor_5.0	19	27,840,275 - 27,840,473	UniSTS	Rnor5.0
RGSC_v3.4	19	16,512,966 - 16,513,164	UniSTS	RGSC3.4
Celera	19	15,256,837 - 15,257,035	UniSTS
Cytogenetic Map	19	p11	UniSTS

BE110336

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	15,687,899 - 15,688,113 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	17,110,942 - 17,111,155	NCBI	Rnor6.0
Rnor_5.0	19	28,178,032 - 28,178,245	UniSTS	Rnor5.0
RGSC_v3.4	19	16,854,644 - 16,854,857	UniSTS	RGSC3.4
Celera	19	15,594,576 - 15,594,789	UniSTS
Cytogenetic Map	19	p11	UniSTS

BF396845

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	15,568,100 - 15,568,223 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	16,991,093 - 16,991,215	NCBI	Rnor6.0
Rnor_5.0	19	28,058,288 - 28,058,410	UniSTS	Rnor5.0
RGSC_v3.4	19	16,733,843 - 16,733,965	UniSTS	RGSC3.4
Celera	19	15,474,907 - 15,475,029	UniSTS
Cytogenetic Map	19	p11	UniSTS

BI295974

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	15,646,245 - 15,646,402 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	17,069,014 - 17,069,170	NCBI	Rnor6.0
Rnor_5.0	19	28,135,813 - 28,135,969	UniSTS	Rnor5.0
RGSC_v3.4	19	16,812,620 - 16,812,776	UniSTS	RGSC3.4
Celera	19	15,552,922 - 15,553,078	UniSTS
Cytogenetic Map	19	p11	UniSTS

BE120169

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	15,531,489 - 15,531,656 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	16,954,524 - 16,954,690	NCBI	Rnor6.0
Rnor_5.0	19	28,021,688 - 28,021,854	UniSTS	Rnor5.0
RGSC_v3.4	19	16,695,715 - 16,695,881	UniSTS	RGSC3.4
Celera	19	15,438,362 - 15,438,528	UniSTS
Cytogenetic Map	19	p11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	38	57	41	19	41	8	11	74	35	41	11	8
Low		5
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001039713	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097564	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097565	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097566	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097567	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097568	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AM233906	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC168239	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211940	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212297	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000305	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000015718 ⟹ ENSRNOP00000015718

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	15,349,696 - 15,692,083 (-)	Ensembl
Rnor_6.0 Ensembl	19	16,772,754 - 17,115,113 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000086829 ⟹ ENSRNOP00000073704

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	15,349,696 - 15,622,364 (-)	Ensembl
Rnor_6.0 Ensembl	19	16,772,744 - 17,045,349 (-)	Ensembl

RefSeq Acc Id:

NM_001039713 ⟹ NP_001034802

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	15,351,202 - 15,692,056 (-)	NCBI
Rnor_6.0	19	16,774,549 - 17,115,098 (-)	NCBI
Rnor_5.0	19	27,803,098 - 28,182,268 (-)	NCBI
RGSC_v3.4	19	16,514,746 - 16,858,800 (-)	RGD
Celera	19	15,258,617 - 15,598,740 (-)	RGD

Sequence:

show sequence

ATGAAGCGCGTCCAGACCGCGGAGGAACGGGAGCGGGAAGCTAAGAAACTGAGGCTCCTCGAGG
AGCTTGAAGACACTTGGCTTCCTTACCTGACCCCCAAAGATGACGAGTTCTATCAGCAGTGGCA
GCTGAAATATCCTAAACTGGTTTTCCGAGAGGCTGGCAGCATACCCGAGGAGCTGCACAAAGAG
GTCCCCGAGGCCTTTCTCACACTGCACAAGCATGGCTGCTTGTTTCGGGACCTGGTGAGGATCC
AAGGCAAAGACGTGCTCACCCCGGTGTCTCGCATCCTCATTGGGGACCCCGGCTGCACCTACAA
GTACTTGAACACCAGGCTCTTCACCGTGCCCTGGCCAGTGAAGGGCTGCACCATCAATTACACA
GAGGCCGAGATTGCCGCCGCATGTCAGACCTTCCTCAAGCTCAATGACTACCTACAGGTCGAGA
CCATCCAGGCCTTGGAAGAACTGGCTATCAAAGAGAAGGCCAATGAAGACGCTGTGCCGTTGTG
CATGGCAGAGTTCCCCAGGGCTGGCGTGGGACCGTCCTGCGATGATGAAGTGGACCTTAAGAGC
AGAGCAGCCTACAACGTGACTTTGCTAAACTTCATGGATCCTCAGAAAATGCCGTACTTGAAAG
AGGAGCCCTATTTCGGCATGGGGAAGATGGCGGTGAGCTGGCACCATGACGAGAACTTGGTGGA
CAGGTCAGCCGTGGCGGTGTACAGCTATAGCTGTGAAGGCTCCGAGGATGAAAGCGATGACGAG
TCCAGCTTCGAAGGCAGAGATCCCGATACGTGGCATGTTGGTTTTAAGATCTCATGGGACATCG
AGACGCCAGGCTTGACAATTCCTCTTCACCAGGGAGACTGCTATTTCATGCTGGATGACCTCAA
TGCCACCCACCAGCACTGTGTTTTGGCTGGCTCACAGCCTCGGTTTAGCTCCACCCACCGCGTG
GCAGAGTGCTCAACAGGCACCTTGGATTATATCTTACAACGCTGCCAGTTGGCACTGCAGAATG
TTCTCAATGACTCGGACAATGGCGACGTCTCGCTGAAGTCCTTCGAGCCTGCAGTTCTGAAACA
AGGAGAAGAGATCCACAACGAGGTCGAGTTTGAGTGGCTGAGGCAGTTCTGGTTTCAAGGAAAT
CGATACAAAATTTGCACTGATTGGTGGTGTGAGCCCATGACTCAGCTGGAGGGGCTGTGGAAGA
AGATGGAGAGTGTGACAAATGCCGTGCTTCGTGAAGTTAAGAGAGAGGGGCTCTCCGTGGAACA
AAGGAGTGAAATTCTGTCTGCCGTCCTGATCCCACTCACCATGCGCCAGAATCTGAGGAAAGAA
TGGCACGCCAGGTGCCAGGCCCGAGTTGTCCGAACTCTACCAGCACAGCAGAAACCAGACTGCC
GGCCATATTGGGAGAAGGATGACCCTTCTATGCCTCTGCCCTTTGACCTCACAGATGTGGTCTC
TGAGATCAGAAGCCAGCTTCTGGAAGCAAGATCCTAGAGGATGCACCAGTCCTAGGTGGAGAAG
GAAAAGATGTCCTTGGCTTTTCTCCCCAGTCCTTG

hide sequence

RefSeq Acc Id:

XM_039097564 ⟹ XP_038953492

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	15,311,827 - 15,692,142 (-)	NCBI

RefSeq Acc Id:

XM_039097565 ⟹ XP_038953493

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	15,284,898 - 15,692,142 (-)	NCBI

RefSeq Acc Id:

XM_039097566 ⟹ XP_038953494

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	15,349,399 - 15,692,088 (-)	NCBI

RefSeq Acc Id:

XM_039097567 ⟹ XP_038953495

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	15,349,399 - 15,627,851 (-)	NCBI

RefSeq Acc Id:

XM_039097568 ⟹ XP_038953496

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	15,349,399 - 15,631,429 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001034802	(Get FASTA)	NCBI Sequence Viewer
	XP_038953492	(Get FASTA)	NCBI Sequence Viewer
	XP_038953493	(Get FASTA)	NCBI Sequence Viewer
	XP_038953494	(Get FASTA)	NCBI Sequence Viewer
	XP_038953495	(Get FASTA)	NCBI Sequence Viewer
	XP_038953496	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI68239	(Get FASTA)	NCBI Sequence Viewer
	CAJ80872	(Get FASTA)	NCBI Sequence Viewer
	Q2A121	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_001034802 ⟸ NM_001039713

- UniProtKB:

Q2A121 (UniProtKB/Swiss-Prot), B4F7E0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKRVQTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLVFREAGSIPEELHKE
VPEAFLTLHKHGCLFRDLVRIQGKDVLTPVSRILIGDPGCTYKYLNTRLFTVPWPVKGCTINYT
EAEIAAACQTFLKLNDYLQVETIQALEELAIKEKANEDAVPLCMAEFPRAGVGPSCDDEVDLKS
RAAYNVTLLNFMDPQKMPYLKEEPYFGMGKMAVSWHHDENLVDRSAVAVYSYSCEGSEDESDDE
SSFEGRDPDTWHVGFKISWDIETPGLTIPLHQGDCYFMLDDLNATHQHCVLAGSQPRFSSTHRV
AECSTGTLDYILQRCQLALQNVLNDSDNGDVSLKSFEPAVLKQGEEIHNEVEFEWLRQFWFQGN
RYKICTDWWCEPMTQLEGLWKKMESVTNAVLREVKREGLSVEQRSEILSAVLIPLTMRQNLRKE
WHARCQARVVRTLPAQQKPDCRPYWEKDDPSMPLPFDLTDVVSEIRSQLLEARS

hide sequence

RefSeq Acc Id:

ENSRNOP00000073704 ⟸ ENSRNOT00000086829

RefSeq Acc Id:

ENSRNOP00000015718 ⟸ ENSRNOT00000015718

RefSeq Acc Id:	XP_038953493 ⟸ XM_039097565
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038953492 ⟸ XM_039097564
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038953494 ⟸ XM_039097566
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038953496 ⟸ XM_039097568
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038953495 ⟸ XM_039097567
- Peptide Label:	isoform X3

Protein Domains

Alpha-ketoglutarate-dependent dioxygenase FTO

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q2A121-F1-model_v2	AlphaFold	Q2A121	1-502	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700971

Promoter ID:

EPDNEW_R11494

Type:

multiple initiation site

Name:

Fto_1

Description:

FTO, alpha-ketoglutarate dependent dioxygenase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	17,115,125 - 17,115,185	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305121	AgrOrtholog
BioCyc Gene	G2FUF-6365	BioCyc
Ensembl Genes	ENSRNOG00000011728	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000015718	ENTREZGENE
	ENSRNOP00000015718.4	UniProtKB/Swiss-Prot
	ENSRNOP00000073704.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000015718	ENTREZGENE
	ENSRNOT00000015718.7	UniProtKB/Swiss-Prot
	ENSRNOT00000086829.2	UniProtKB/TrEMBL
Gene3D-CATH	1.20.58.1470	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	2.60.120.590	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	AlkB-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FTO	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FTO_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FTO_C_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FTO_cat_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:291905	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	291905	ENTREZGENE
PANTHER	ALPHA-KETOGLUTARATE-DEPENDENT DIOXYGENASE FTO	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR31291	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	FTO_CTD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FTO_NTD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Fto	PhenoGen
SMART	FTO_NTD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2K675_RAT	UniProtKB/TrEMBL
	B4F7E0	ENTREZGENE, UniProtKB/TrEMBL
	FTO_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-09-21	Fto	FTO, alpha-ketoglutarate dependent dioxygenase	Fto	fat mass and obesity associated	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-06	Fto	fat mass and obesity associated	RGD1305121_predicted	similar to FTO (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2007-04-06		similar to FTO (predicted)	RGD1305121_predicted	similar to fatso (predicted)	Symbol and Name updated to reflect Human and Mouse nomenclature	1299863	APPROVED
2005-01-20	RGD1305121_predicted	similar to fatso (predicted)	LOC291905_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC291905_predicted	similar to fatso (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM