Wnt9a (Wnt family member 9A) - Rat Genome Database

Name: Wnt9a
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Wnt9a (Wnt family member 9A) Rattus norvegicus

Analyze

Symbol:

Wnt9a

Name:

Wnt family member 9A

RGD ID:

1305018

Description:

Predicted to enable receptor ligand activity. Predicted to be involved in negative regulation of cell population proliferation. Predicted to act upstream of or within several processes, including embryonic morphogenesis; negative regulation of chondrocyte differentiation; and positive regulation of smoothened signaling pathway. Predicted to be located in extracellular region. Human ortholog(s) of this gene implicated in pancreatic cancer. Orthologous to human WNT9A (Wnt family member 9A); PARTICIPATES IN altered Wnt signaling, canonical pathway; pancreatic cancer pathway; Wnt signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC287357; protein Wnt-9a; wingless related MMTV integration site 9A; wingless-type MMTV integration site 9A; wingless-type MMTV integration site family, member 9A

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	44,094,140 - 44,121,134 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	44,094,140 - 44,121,133 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	48,788,493 - 48,815,787 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	10	48,278,864 - 48,306,158 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	10	43,782,462 - 43,809,760 (+)	NCBI	Rnor_WKY
Rnor_6.0	10	45,659,045 - 45,686,103 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	45,659,143 - 45,681,393 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	45,414,100 - 45,441,651 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	45,613,668 - 45,641,488 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	45,611,817 - 45,652,968 (+)	NCBI
Celera	10	43,356,927 - 43,383,916 (+)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

breast cancer (ISO)

cholangiocarcinoma (ISO)

gastrointestinal stromal tumor (ISO)

genetic disease (ISO)

pancreatic cancer (ISO)

parathyroid carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

aristolochic acid A (ISO)

avobenzone (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bleomycin A2 (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

chlorpyrifos (EXP)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

deguelin (ISO)

diazinon (EXP)

dieldrin (EXP)

dimethylselenide (ISO)

dioxygen (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fenamidone (ISO)

fluoranthene (ISO)

gentamycin (EXP)

lead diacetate (ISO)

Licochalcone B (ISO)

methapyrilene (ISO)

mitomycin C (ISO)

nickel atom (EXP)

nickel subsulfide (EXP)

Nor-9-carboxy-delta9-THC (ISO)

paracetamol (EXP)

potassium dichromate (ISO)

reactive oxygen species (ISO)

sodium fluoride (ISO)

Soman (EXP)

testosterone (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

triclosan (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anatomical structure development (ISO)

biological_process (ND)

canonical Wnt signaling pathway (ISO)

cartilage development (ISO)

chondrocyte differentiation (ISO)

embryonic forelimb morphogenesis (ISO)

embryonic skeletal system morphogenesis (ISO)

epithelial cell differentiation (ISO)

negative regulation of cartilage development (ISO)

negative regulation of cell population proliferation (ISO)

negative regulation of chondrocyte differentiation (ISO)

negative regulation of cysteine-type endopeptidase activity involved in apoptotic process (ISO)

negative regulation of programmed cell death (ISO)

positive regulation of epithelial cell differentiation (ISO)

positive regulation of smoothened signaling pathway (ISO)

smoothened signaling pathway (ISO)

Cellular Component

cellular_component (ND)

extracellular region (IEA)

Molecular Function

molecular_function (ND)

protein binding (ISO)

receptor ligand activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

altered Wnt signaling, canonical pathway (ISO)

basal cell carcinoma pathway (IEA)

Hedgehog signaling pathway (IEA)

pancreatic cancer pathway (ISO)

Wnt signaling pathway (IEA,ISO)

Wnt signaling, canonical pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Core signaling pathways in human pancreatic cancers revealed by global genomic analyses.	Jones S, etal., Science. 2008 Sep 26;321(5897):1801-6. Epub 2008 Sep 4.
4.	Expression of WNT14 and WNT14B mRNAs in human cancer, up-regulation of WNT14 by IFNgamma and up-regulation of WNT14B by beta-estradiol.	Kirikoshi H, etal., Int J Oncol. 2001 Dec;19(6):1221-5.
5.	Identification of key genes and pathways associated with cholangiocarcinoma development based on weighted gene correlation network analysis.	Liu J, etal., PeerJ. 2019 Oct 31;7:e7968. doi: 10.7717/peerj.7968. eCollection 2019.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Comprehensive gene review and curation	RGD comprehensive gene curation
12.	The Wnt Homepage	Roel Nusse - Howard Hughes Medical Institute and the Department of Developmental Biology at Stanford University, California, USA
13.	Wnt9a signaling is required for joint integrity and regulation of Ihh during chondrogenesis.	Spater D, etal., Development. 2006 Aug;133(15):3039-49. Epub 2006 Jul 3.
14.	Alternative wnt signaling is initiated by distinct receptors.	van Amerongen R, etal., Sci Signal. 2008 Sep 2;1(35):re9.

Additional References at PubMed

PMID:15371327	PMID:15809769	PMID:17351820	PMID:18056042	PMID:19047045	PMID:19422823	PMID:23376485	PMID:28733458

Genomics

Comparative Map Data

Wnt9a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	44,094,140 - 44,121,134 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	44,094,140 - 44,121,133 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	48,788,493 - 48,815,787 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	10	48,278,864 - 48,306,158 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	10	43,782,462 - 43,809,760 (+)	NCBI	Rnor_WKY
Rnor_6.0	10	45,659,045 - 45,686,103 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	45,659,143 - 45,681,393 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	45,414,100 - 45,441,651 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	45,613,668 - 45,641,488 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	45,611,817 - 45,652,968 (+)	NCBI
Celera	10	43,356,927 - 43,383,916 (+)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

WNT9A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	227,918,656 - 227,947,932 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	1	227,918,656 - 227,947,932 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	228,106,357 - 228,135,633 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	226,175,320 - 226,202,222 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	224,415,431 - 224,442,334	NCBI
Celera	1	201,300,553 - 201,327,066 (-)	NCBI		Celera
Cytogenetic Map	1	q42.13	NCBI
HuRef	1	198,625,076 - 198,651,433 (-)	NCBI		HuRef
CHM1_1	1	229,381,547 - 229,408,063 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	227,107,683 - 227,136,953 (-)	NCBI		T2T-CHM13v2.0

Wnt9a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	59,197,675 - 59,224,378 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	59,197,754 - 59,224,378 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	59,306,849 - 59,333,552 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	59,306,928 - 59,333,552 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	59,120,432 - 59,147,054 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	59,123,125 - 59,149,747 (+)	NCBI		MGSCv36	mm8
Celera	11	64,072,296 - 64,098,904 (+)	NCBI		Celera
Cytogenetic Map	11	B1.3	NCBI

Wnt9a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955581	421,451 - 438,380 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955581	422,028 - 438,321 (+)	NCBI	ChiLan1.0	ChiLan1.0

WNT9A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	1	208,299,208 - 208,306,332 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	208,300,609 - 208,327,191 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	1	203,320,990 - 203,350,599 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

WNT9A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	946,843 - 959,289 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	953,244 - 959,295 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	191,119 - 211,638 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	660,643 - 681,204 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	660,636 - 681,210 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	851,177 - 871,745 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	631,944 - 652,482 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	619,946 - 641,087 (+)	NCBI		UU_Cfam_GSD_1.0

Wnt9a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	87,895,539 - 87,904,616 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936864	239,651 - 244,312 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936864	216,381 - 245,885 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

WNT9A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	51,102,763 - 51,128,346 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	51,102,757 - 51,128,346 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	53,983,861 - 54,009,486 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

WNT9A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	1,759,047 - 1,787,510 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	1,781,826 - 1,788,663 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666055	1,641,148 - 1,670,756 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Wnt9a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624937	776,810 - 797,310 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624937	776,810 - 797,365 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Wnt9a
107 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	439
Count of miRNA genes:	223
Interacting mature miRNAs:	296
Transcripts:	ENSRNOT00000058327
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	42876766	79813922	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	41944526	78307017	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
1354614	Hpcl1	Hepatic cholesterol level QTL 1	3.3		liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	35392267	51793994	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35392267	64155584	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
61332	Eau3	Experimental allergic uveoretinitis QTL 3		0.004	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	34490559	45579777	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35392457	63642539	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	28875650	52200160	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	17907113	51786432	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium								1			1
Low	1	38	4	3	1	3	8	10	74	19	29	11	8
Below cutoff	2	5	39	25	14	25				14	6

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001105783	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006246448	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC121055	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000220	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000058327 ⟹ ENSRNOP00000055129

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	44,094,140 - 44,121,133 (+)	Ensembl
Rnor_6.0 Ensembl	10	45,659,143 - 45,681,393 (+)	Ensembl

RefSeq Acc Id:

NM_001105783 ⟹ NP_001099253

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	44,094,140 - 44,121,134 (+)	NCBI
Rnor_6.0	10	45,659,056 - 45,686,089 (+)	NCBI
Rnor_5.0	10	45,414,100 - 45,441,651 (+)	NCBI
RGSC_v3.4	10	45,613,668 - 45,641,488 (+)	RGD
Celera	10	43,356,927 - 43,383,916 (+)	RGD

Sequence:

show sequence

GGCTGCGGACGCTATAAGAGGGCGGCGGTCGCGGCGCGCCCTGCGCGGAGCCCGGAGCGCGATG
GTCAGCCGCCGCGGCGCGGCAAGATGCTGGATGGGTCCCTTCTGGCGCGCTGGCTGGCCGCGGC
CTTCGGGCTGACGCTGCTGCTCGCCGCGCTGCGCCCTTCGGCCGCCTACTTCGGGCTAACAGGC
AGTGAACCCCTGACTATACTCCCTCTAACCCTGGAGACCGAGGCTGCAGCCCAAGCTCACTACA
AGGCCTGCGACAGGCTGAAGCTGGAGCGCAAGCAGCGTCGCATGTGCCGCAGGGACCCGGGCGT
GGCGGAGACACTGGTGGAGGCTGTGAGCATGAGTGCCCTGGAGTGCCAGTACCAGTTCCGCTTC
GAGCGCTGGAACTGCACCCTGGAGGGCCGCTACCGAGCCAGCCTGCTCAAGCGAGGCTTCAAGG
AGACTGCTTTCCTCTACGCCATCTCTTCTGCGGGTCTGACGCATGCACTAGCCAAGGCCTGCAG
TGCAGGTCGCATGGAGCGCTGCACTTGTGACGAGGCACCTGACCTGGAAAACCGCGAGGCCTGG
CAGTGGGGCGGCTGTGGGGACAACCTCAAGTACAGCAGCAAGTTTGTCAAGGAGTTCCTGGGCC
GGCGGTCTACAAGGATCTGCGAGCCCGAGTGGACTTCCACAACAACCTCGTGGGTGTGAAGGCA
AGCTGGGTAATAAAGGCTGGAGTGGAGACCACTTGCAAATGCCATGGCGTGTCTGGCTCCTGCA
CGGTGCGGACCTGCTGGCGGCAGCTAGCACCCTTCCACGAGGTGGGCAAGCACCTAAAACACAA
ATATGAGACCTCTCTCAAGGTGGGCAGCACTACCAATGAAGCCACCGGCGAGGCGGGTGCCATC
TCCCCACCGCGGGGCCGGGCGTCCGGGTCCGGAGGCGGTGACCCCTTACCCCGAACACCAGAGC
TGGTACACCTGGACGACTCTCCCAGCTTCTGCCTGGCTGGCCGATTTTCCCCTGGCACGGCAGG
CCGCAGGTGTCACCGAGAGAAGAACTGTGAGAGTATTTGTTGTGGCCGCGGCCACAACACACAG
AGCCGTGTGGTGACAAGGCCCTGCCAATGCCAGGTCCGCTGGTGCTGCTATGTGGAGTGCAGGC
AGTGTACACAGAGAGAGGAGGTCTATACCTGCAAGGGCTGACCCGAGGCCCTGCGGCCCCGCCA
CAAGCGGTGTGGGCTTTGCATACAGCGCCGGAAGAATTCTACGCCTGCAGGAGCTGACTCCCCG
GCCCTGCCAGCCTTTCAGCGGGGAGTGTAGGCTTTGCACACAGTGCAAAGGGTCTTAACCTGCG
TGGAGTGAGCCCTGCAGGTCCAGCCTGTCCTGCTGTGTGGGGCACGGGTGTTATAAACAACACA
AAAGGTCTGCAAGGAAGGAGAGATGCCCCCAGCACTTGGGCCCTGGTATACAGACAGCTGGTTG
GCTGTCTCCCGGCCCAGAGGGCGGGGCTGGCCCCTGTCTGGCCTCCTCGACCCTTTGCTTATGC
CTTGGGCCTGAGCTTCCCGCCCCTCCTGACCCGAGAGCGTTGCAGTAATGCTTTCTCAGTTGCC
TGTGTCCCTGACATATCAGTATAGCCCTTGTCAGGGACCAGTGTGTCGACTAGCCCTCCGTGCC
TCTTGGCTTCCTCTGAGGCTTGGAGGGCAGGTGCACCTTCATAATCACATGGCCTCATCTGGCC
CAGCAGCCTGACGCCAGCACTGTCTTCAGAGAGCCAAACCACTAGGAGAGGGCAGCCACTCCAT
CTACAGGGCGTAGCCTCTGGCCCTCTGACCCTGAGCACTTCCTTGGAGTATCAGTGACTTTTAA
ATTATTATTATTTAACTAATATAGTAATTATTATTTTCCCTGTCCCCTTACCTCCTAATCTGTG
GCTTTTTCCGTCTGACCTGCCCCAGGCCCAGTCAAGCCAATCTGGGAGGCCTTGCCTTCCCTCC
CTTCATACTCCCTCCTCGTCTGCTTGCTCTAGTTTGAAACCACTAAATCAAGGTCACGTTTGGA
AAGAATGGAGCAATAGAGTCTAGCCGTGGCCCACAAGGCTTCTGGAAGCCCACTCCCCGATTCT
ACCTTACCTGGGGTCAGAGACCCTTGGTGGTCCCTGCTCTGTGCCCTGCCGGTGCAGAGATCAG
GTTGCTGGATATAGATTGGGGGTCTGGGGCACTAGAGCCATGGGCTCGGCGACAGGGGCAGGGT
CAGCTTTTTGATTGTCCATCTCAGGAAGCCATTCTTGCTCTGTGTCCCCAAGGGAGGTATGGAG
ACAGACACACTTGCTCTCATCAGGTCTCGCTGATGTCTCTGCAGGGGAAAGGTGGCTACACTGA
GCTGGCGATGAGTGTGTGTGCATGTGTTGTGTGAGTGTGCGAGTGTATGTATTCCGAGCTGGCA
TGGTCAGCATCCAGCGGCCCGTGTCCCTCTGCAGTATGGTGACTCTTTGGCTCCCAGAAAGCCC
AGCCTTAGGTCCGTGGGAACCCCATGGCTGTACAGGCTAGAGTGTAGGCAGGTGGCAGGCAAGG
AGTCAGGCACTACTGAGGAAAGAAGCACCAGGGGTCCAGAAGACCCAAGCATGGGGTGGCGGTG
GGACTGTGTCTTAAAGGAAACCTATTTATGTGGATGAGAGCCTCTGGTCTCTATTGGATGTGTA
AATAGCAAAGTTTATTCTCCTGTGGTTCCTAGAGCCCACCGATGAATGCCACGTTCCCAGGATG
CGTGTGGGTGGCGGTATGCAGTGGCTGGTGGGTGGGAGTGTACCCCGTACTCTTCAGATGCCTG
TACCCAGTCACACTACCACCGCCGACTGGAGCTCCATCTCTGTCAGATCTGGGGGAAAGAGCCT
ACCAGTCCAGAGGAAAGAATATTTTTATCGAATGCCACATTTAGCTCTATGTCCTCAATATTCA
GAAAAGCTATTTTTTAAAACAAGGCAGAATGAAACTATCTGCCGGCTGGTTTGTTTCTGTATAA
ATATATACTAGAATGTCTTTCTGGATGAAGCGACTCCCACAGGCCAAAGCCTCTTTGATCTTCT
TCTCTTCTATGGGCAGTAGAGTGAGCAGCTGCCCTGCTCCCGCCGGCCACCCAGGTTATGCCGG
CACTGAGGCGCACTGCTGGCCCGCCTGGCAGTGGACACACAAGGGAGCTGTCTTTGTGTGGAGT
CCTGTGCAGCCTGTGATTTCTCTACCTCAACTGTGTGGCGAGTAGGTGTGAACCTGAGTGACTG
CAGAGAATGTATTTATTTAACAGCTTTGTGTAACAAAACCAGAAACAAATGGAAACACTAAATA
AATGTATTT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099253	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM04607	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001099253 ⟸ NM_001105783
- Peptide Label:	precursor
- UniProtKB:	D3ZF63 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLDGSLLARWLAAAFGLTLLLAALRPSAAYFGLTGSEPLTILPLTLETEAAAQAHYKACDRLKL ERKQRRMCRRDPGVAETLVEAVSMSALECQYQFRFERWNCTLEGRYRASLLKRGFKETAFLYAI SSAGLTHALAKACSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVKEFLGRRSTRICE PEWTSTTTSWV hide sequence

RefSeq Acc Id:

ENSRNOP00000055129 ⟸ ENSRNOT00000058327

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZF63-F1-model_v2	AlphaFold	D3ZF63	1-203	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697234

Promoter ID:

EPDNEW_R7758

Type:

single initiation site

Name:

Wnt9a_1

Description:

Wnt family member 9A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	45,659,098 - 45,659,158	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305018	AgrOrtholog
BioCyc Gene	G2FUF-24902	BioCyc
Ensembl Genes	ENSRNOG00000003066	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000055129	ENTREZGENE
	ENSRNOP00000055129.4	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000058327	ENTREZGENE
	ENSRNOT00000058327.4	UniProtKB/TrEMBL
Gene3D-CATH	3.30.2460.20	UniProtKB/TrEMBL
InterPro	Wnt14	UniProtKB/TrEMBL
	Wnt_C	UniProtKB/TrEMBL
	Wnt_CS	UniProtKB/TrEMBL
	Wnt_SF	UniProtKB/TrEMBL
NCBI Gene	287357	ENTREZGENE
PANTHER	PTHR12027:SF75	UniProtKB/TrEMBL
	Wnt	UniProtKB/TrEMBL
Pfam	wnt	UniProtKB/TrEMBL
PhenoGen	Wnt9a	PhenoGen
PRINTS	WNT14PROTEIN	UniProtKB/TrEMBL
	WNTPROTEIN	UniProtKB/TrEMBL
PROSITE	WNT1	UniProtKB/TrEMBL
SMART	WNT1	UniProtKB/TrEMBL
UniProt	D3ZF63	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-29	Wnt9a	Wnt family member 9A	Wnt9a	wingless-type MMTV integration site family, member 9A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-14	Wnt9a	wingless-type MMTV integration site family, member 9A	Wnt9a	wingless-type MMTV integration site 9A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Wnt9a	wingless-type MMTV integration site 9A	Wnt9a_predicted	wingless related MMTV integration site 9A (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Wnt9a_predicted	wingless related MMTV integration site 9A (predicted)		wingless-type MMTV integration site 9A (predicted)	Name updated	1299863	APPROVED
2005-01-12	Wnt9a_predicted	wingless-type MMTV integration site 9A (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)