Advanced Search (OLGA)

Gene: Cct6a (chaperonin containing TCP1 subunit 6A) Rattus norvegicus

Analyze

Symbol:

Cct6a

Name:

chaperonin containing TCP1 subunit 6A

RGD ID:

1304763

Description:

Predicted to enable WD40-repeat domain binding activity; protein folding chaperone; and unfolded protein binding activity. Predicted to be involved in several processes, including chaperone mediated protein folding independent of cofactor; positive regulation of protein localization to Cajal body; and positive regulation of telomerase RNA localization to Cajal body. Predicted to act upstream of or within binding activity of sperm to zona pellucida. Predicted to be located in several cellular components, including acrosomal vesicle; cell body; and microtubule. Predicted to be part of chaperonin-containing T-complex and zona pellucida receptor complex. Orthologous to human CCT6A (chaperonin containing TCP1 subunit 6A); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

chaperonin containing Tcp1, subunit 6A (zeta 1); chaperonin subunit 6a (zeta); LOC288620; MGC125121; T-complex protein 1 subunit zeta

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CCT6A (chaperonin containing TCP1 subunit 6A)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Cct6a (chaperonin containing TCP1 subunit 6A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cct6a (chaperonin containing TCP1 subunit 6A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CCT6A (chaperonin containing TCP1 subunit 6A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CCT6A (chaperonin containing TCP1 subunit 6A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cct6a (chaperonin containing TCP1 subunit 6A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CCT6A (chaperonin containing TCP1 subunit 6A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CCT6A (chaperonin containing TCP1 subunit 6A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cct6a (chaperonin containing TCP1 subunit 6A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CCT6B (chaperonin containing TCP1 subunit 6B)	HGNC	OrthoDB
Homo sapiens (human):	TAF6 (TATA-box binding protein associated factor 6)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CCT6A (chaperonin containing TCP1 subunit 6A)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cct6a (chaperonin containing TCP1 subunit 6A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cct6a (chaperonin containing TCP1, subunit 6A (zeta 1))	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CCT6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CCT6	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cct-6	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cct6a	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)

Related Pseudogenes:

Cct6a-ps1 Cct6a-ps11 Cct6a-ps14 Cct6a-ps2 Cct6a-ps3 Cct6a-ps4 Cct6a-ps5 Cct6a-ps6 Cct6a-ps7 Cct6a-ps8 Cct6a-ps9

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	32,508,842 - 32,519,072 (-)	NCBI		GRCr8
mRatBN7.2	12	26,872,736 - 26,883,125 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	26,872,574 - 26,883,337 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	28,009,963 - 28,019,744 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	28,620,502 - 28,630,283 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	27,681,988 - 27,691,769 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	30,491,584 - 30,501,813 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	30,491,416 - 30,501,860 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	32,433,505 - 32,443,734 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	27,992,348 - 28,002,578 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	27,855,700 - 27,866,156 (+)	NCBI
Celera	12	28,578,429 - 28,588,659 (-)	NCBI		Celera
Cytogenetic Map	12	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

pleomorphic xanthoastrocytoma (ISO)

PSPH deficiency (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrotoluene (EXP)

2,4-dinitrotoluene (EXP)

2,6-dimethoxyphenol (ISO)

2,6-dinitrotoluene (EXP)

2-amino-14,16-dimethyloctadecan-3-ol (ISO)

4,4'-sulfonyldiphenol (ISO)

4-amino-2,6-dinitrotoluene (EXP)

acrolein (ISO)

acrylamide (EXP,ISO)

aflatoxin B1 (EXP)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

aminoglutethimide (ISO)

amitrole (EXP)

arsenous acid (ISO)

benzatropine (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

C60 fullerene (EXP)

caffeine (ISO)

calcium dichloride (ISO)

cannabidiol (ISO)

captan (ISO)

carbon nanotube (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

CU-O LINKAGE (ISO)

Cuprizon (EXP,ISO)

cyclosporin A (ISO)

DDE (ISO)

deguelin (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

disodium selenite (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

finasteride (EXP)

fipronil (EXP)

flutamide (EXP)

folic acid (ISO)

folpet (ISO)

FR900359 (ISO)

furfural (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

irinotecan (ISO)

ivermectin (ISO)

lead(0) (ISO)

lithocholic acid (ISO)

lovastatin (ISO)

megestrol acetate (ISO)

methyl methanesulfonate (ISO)

N-nitrosomorpholine (EXP)

nefazodone (EXP)

nimesulide (EXP)

nitrates (ISO)

ozone (ISO)

paracetamol (ISO)

paraquat (EXP)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (EXP,ISO)

propiconazole (ISO)

rotenone (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

sodium dichromate (EXP,ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

trichloroethene (EXP,ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

tunicamycin (ISO)

valdecoxib (EXP)

valproic acid (EXP,ISO)

vinclozolin (EXP)

warfarin (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

binding of sperm to zona pellucida (ISO)

chaperone mediated protein folding independent of cofactor (IEA)

chaperone-mediated protein folding (IEA,ISO)

positive regulation of establishment of protein localization to telomere (IEA,ISO)

positive regulation of protein localization to Cajal body (ISO)

positive regulation of telomerase RNA localization to Cajal body (ISO)

positive regulation of telomere maintenance via telomerase (IEA,ISO)

protein folding (IBA,IEA,ISO)

protein stabilization (IEA,ISO)

Cellular Component

acrosomal vesicle (ISO)

cell body (ISO)

chaperonin-containing T-complex (IBA,IEA,ISO)

cytoplasm (IEA)

cytosol (IEA,ISO)

microtubule (IEA,ISO)

zona pellucida receptor complex (ISO)

Molecular Function

ATP binding (IEA)

ATP hydrolysis activity (IEA)

ATP-dependent protein folding chaperone (IEA)

nucleotide binding (IEA)

protein binding (ISO)

protein folding chaperone (IEA,ISO)

unfolded protein binding (IBA,IEA)

WD40-repeat domain binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	The EARP Complex and Its Interactor EIPR-1 Are Required for Cargo Sorting to Dense-Core Vesicles.	Topalidou I, etal., PLoS Genet. 2016 May 18;12(5):e1006074. doi: 10.1371/journal.pgen.1006074. eCollection 2016 May.

Additional References at PubMed

PMID:7828721	PMID:7953530	PMID:9013858	PMID:12477932	PMID:19056867	PMID:20193073	PMID:20458337	PMID:21525035	PMID:21880732	PMID:22658674	PMID:23011926	PMID:23106098
PMID:23376485	PMID:23533145	PMID:23716698	PMID:23979707	PMID:25467444	PMID:33450132

Genomics

Comparative Map Data

Cct6a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	32,508,842 - 32,519,072 (-)	NCBI		GRCr8
mRatBN7.2	12	26,872,736 - 26,883,125 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	26,872,574 - 26,883,337 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	28,009,963 - 28,019,744 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	28,620,502 - 28,630,283 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	27,681,988 - 27,691,769 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	30,491,584 - 30,501,813 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	30,491,416 - 30,501,860 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	32,433,505 - 32,443,734 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	27,992,348 - 28,002,578 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	27,855,700 - 27,866,156 (+)	NCBI
Celera	12	28,578,429 - 28,588,659 (-)	NCBI		Celera
Cytogenetic Map	12	q13	NCBI

CCT6A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	56,051,765 - 56,063,989 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	56,051,685 - 56,063,989 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	56,119,458 - 56,131,682 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	56,086,872 - 56,099,176 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	55,893,586 - 55,905,891	NCBI
Celera	7	67,172,779 - 67,185,081 (+)	NCBI		Celera
Cytogenetic Map	7	p11.2	NCBI
HuRef	7	55,933,178 - 55,945,465 (+)	NCBI		HuRef
CHM1_1	7	56,122,415 - 56,134,705 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	56,211,599 - 56,223,813 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	56,123,625 - 56,135,929 (+)	NCBI

Cct6a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	129,864,420 - 129,875,284 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	129,864,062 - 129,875,212 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	129,787,356 - 129,846,443 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	129,786,998 - 129,846,371 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	130,293,261 - 130,300,376 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv37	5	130,320,838 - 130,322,231 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	130,102,094 - 130,109,209 (+)	NCBI		MGSCv36	mm8
Celera	5	126,831,958 - 126,842,310 (+)	NCBI		Celera
Cytogenetic Map	5	G1.3	NCBI
cM Map	5	68.26	NCBI

Cct6a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955456	8,223,774 - 8,237,966 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955456	8,223,785 - 8,236,760 (+)	NCBI	ChiLan1.0	ChiLan1.0

CCT6A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	60,903,879 - 60,915,550 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	109,228,731 - 109,240,863 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	56,664,757 - 56,677,000 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	57,087,935 - 57,099,519 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	57,087,072 - 57,098,613 (+)	Ensembl	panpan1.1		panPan2

CCT6A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	546,278 - 556,996 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	546,307 - 557,001 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	2,245,558 - 2,256,308 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	349,896 - 360,647 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	349,907 - 361,209 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	293,657 - 304,407 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	287,738 - 298,489 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	458,965 - 469,718 (+)	NCBI		UU_Cfam_GSD_1.0

Cct6a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	126,136,398 - 126,149,056 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936543	7,887,414 - 7,900,200 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936543	7,887,511 - 7,900,174 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CCT6A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	16,843,804 - 16,858,819 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	16,843,801 - 16,858,819 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	17,180,645 - 17,194,658 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CCT6A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	2,715,990 - 2,728,397 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	2,718,975 - 2,728,239 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	179,918,592 - 179,930,935 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cct6a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	8,247,469 - 8,258,978 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624740	8,247,477 - 8,258,335 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cct6a
164 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	68
Count of miRNA genes:	62
Interacting mature miRNAs:	65
Transcripts:	ENSRNOT00000001227
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	23081340	44726024	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	8525423	28064601	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	15872653	32974238	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	24139202	36638073	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	23081340	43551788	Rat
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	24234777	31894213	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
1300157	Rf21	Renal function QTL 21	4.4		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	12	9318216	32103380	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	28064557	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	19835789	38193007	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1581516	Cm56	Cardiac mass QTL 56	4.2	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	1	29333307	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	13635523	30827399	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	36247923	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	8449490	28302290	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat

Markers in Region

RH134402

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	26,872,658 - 26,872,850 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	30,491,507 - 30,491,698	NCBI	Rnor6.0
Rnor_5.0	12	32,433,428 - 32,433,619	UniSTS	Rnor5.0
RGSC_v3.4	12	28,002,464 - 28,002,655	UniSTS	RGSC3.4
RGSC_v3.4	5	8,729,076 - 8,729,267	UniSTS	RGSC3.4
Celera	12	28,578,352 - 28,578,543	UniSTS
Cytogenetic Map	12	q13	UniSTS
Cytogenetic Map	9	q36	UniSTS

RH138649

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	26,882,098 - 26,882,263 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	30,500,945 - 30,501,109	NCBI	Rnor6.0
Rnor_5.0	12	32,442,866 - 32,443,030	UniSTS	Rnor5.0
RGSC_v3.4	12	27,993,052 - 27,993,216	UniSTS	RGSC3.4
Celera	12	28,587,791 - 28,587,955	UniSTS
RH 3.4 Map	12	453.1	UniSTS
Cytogenetic Map	9	q36	UniSTS
Cytogenetic Map	12	q13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001033684	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC079075	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC091282	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC104703	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216833	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218432	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224176	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231944	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001227 ⟹ ENSRNOP00000001227

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	26,872,574 - 26,882,974 (-)	Ensembl
Rnor_6.0 Ensembl	12	30,491,416 - 30,501,860 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093152

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	12	30,497,406 - 30,498,864 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093591

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	12	30,500,927 - 30,501,834 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107456 ⟹ ENSRNOP00000092130

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	26,872,581 - 26,883,337 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107709 ⟹ ENSRNOP00000083923

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	26,872,576 - 26,883,018 (-)	Ensembl

RefSeq Acc Id:

NM_001033684 ⟹ NP_001028856

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	32,508,842 - 32,519,072 (-)	NCBI
mRatBN7.2	12	26,872,736 - 26,882,967 (-)	NCBI
Rnor_6.0	12	30,491,584 - 30,501,813 (-)	NCBI
Rnor_5.0	12	32,433,505 - 32,443,734 (-)	NCBI
RGSC_v3.4	12	27,992,348 - 28,002,578 (+)	RGD
Celera	12	28,578,429 - 28,588,659 (-)	RGD

Sequence:

show sequence

CCCTGAGCTCGACCAGCCATGGCGGCGGTGAAGACCCTAAATCCCAAAGCCGAGGTGGCCCGGG
CGCAGGCAGCGCTGGCGGTGAACATCAGCGCGGCACGGGGCCTGCAGGATGTTCTGAGGACCAA
CTTGGGCCCTAAAGGCACCATGAAGATGCTTGTATCTGGTGCTGGAGACATCAAACTTACTAAA
GATGGCAATGTGCTACTTCATGAAATGCAAATTCAACACCCAACAGCCTCTTTGATAGCAAAAG
TGGCTACAGCGCAGGATGACATAACCGGCGATGGCACTACATCCAATGTCCTCATCATCGGAGA
GCTGCTCAAACAAGCGGACCTCTACATTTCTGAAGGTCTCCATCCCAGAATAATAACCGAAGGC
TTTGAAGCTGCAAAGGAAAAGGCACTCCAGTTTTTGGAACAAGTCAAAGTAAGCAAAGAGATGG
ACAGAGAAACACTCATCGATGTGGCCAGGACATCTCTGCGGACTAAAGTTCATGCTGAGCTTGC
AGATGTCTTGACAGAGGCTGTGGTGGACTCCATTTTGGCCATTAGGAAAAAAGATGAGCCCATT
GACCTCTTCATGGTTGAGATCATGGAGATGAAGCATAAATCTGAAACTGATACAAGCTTAATCA
GAGGGCTTGTTTTGGATCATGGAGCACGGCATCCTGATATGAAGAAAAGAGTAGAAAATGCCTA
CATCCTCACATGCAACGTGTCCTTGGAGTATGAGAAGACAGAAGTGAATTCTGGGTTTTTTTAC
AAGAGTGCAGAAGAGAGAGAGAAACTAGTAAAGGCTGAAAGAAAATTCATTGAAGATAGAGTTA
AAAAAATCGTAGAACTGAAGAAGAAAGTCTGTGGTGATTCAGATAAAGGATTTGTCGTTATTAA
TCAAAAGGGGATTGACCCCTTCTCTTTAGATGCCCTCGCGAAAGAAGGCATCGTAGCTCTGCGC
AGAGCCAAGAGGAGAAACATGGAGAGGCTGACTCTTGCTTGTGGTGGGATAGCTCTGAACTCCT
TTGATGACCTGAATCCTGACTGTTTGGGACATGCAGGGCTTGTCTATGAGTATACATTGGGTGA
GGAGAAGTTCACCTTTATTGAGAAATGTAACAATCCCCGTTCTGTCACTTTACTGGTTAAAGGA
CCAAACAAGCACACGCTGACTCAGATCAAGGATGCAATCAGAGATGGCTTGAGGGCTGTCAAAA
ATGCTATTGATGATGGCTGTGTTGTCCCGGGTGCAGGTGCAGTTGAAGTGGCACTGGCAGAGGC
TCTGATTAAATACAAGCCCAGTGTGAAGGGCAGAGCTCAGCTTGGGGTCCAGGCATTTGCAGAT
GCCTTGCTCATCATTCCCAAGGTTCTTGCGCAGAACTCTGGTTTTGACCTTCAGGAAACATTAG
TTAAAGTTCAAGCTGAACATTCAGAATCCGGTCAGCTTGTGGGTGTGGATCTAAACACAGGTGA
GCCAATGGTGGCCGCAGAAATGGGTGTGTGGGATAACTACTGTGTGAAGAAGCAGCTGCTTCAC
TCCTGTACTGTGATCGCCACCAACATTCTCCTGGTTGACGAGATCATGAGAGCTGGGATGTCCT
CTCTGAAGGGCTGAAGTCTGCCTGGGATGCTACAGAATGTTGGGGGGGGGGGGGGTTGTCCAAG
CTTCAAGTGATTTGGAAAAGAATTTTCTCTTCCTGATTGGAGAAAAGGAACAGGACATTTGGCA
CCTATTCAAATTATAATACTGTAAATTTTATTTAATTTTTTTTTGCATTGAGTGAATACACTTA
AAGCAGGTCTTTTTAAATCCACTGAACAAGATGTTTTCGTTACAGTGATACAAAATTACATAAT
AAGCATTGTTGTCTACCTTGTTCCTCAAGTGTTCTTTGAAATTTTATAATGGTTTTCTCCTAAA
TAAGGCATGGCGATTCCTGCCTGTAAGCCTAGCACTTTGGAAATAAAGTCAGAAGTTCTGCACC
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001028856	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91282	(Get FASTA)	NCBI Sequence Viewer
	AAI04704	(Get FASTA)	NCBI Sequence Viewer
	EDM13487	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001227.4
	ENSRNOP00000083923
	ENSRNOP00000083923.1
	ENSRNOP00000092130.1

RefSeq Acc Id:

NP_001028856 ⟸ NM_001033684

- UniProtKB:

Q3MHS9 (UniProtKB/TrEMBL), A0A8I6ADF8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAVKTLNPKAEVARAQAALAVNISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLL
HEMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGFEAAKE
KALQFLEQVKVSKEMDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIRKKDEPIDLFMVE
IMEMKHKSETDTSLIRGLVLDHGARHPDMKKRVENAYILTCNVSLEYEKTEVNSGFFYKSAEER
EKLVKAERKFIEDRVKKIVELKKKVCGDSDKGFVVINQKGIDPFSLDALAKEGIVALRRAKRRN
MERLTLACGGIALNSFDDLNPDCLGHAGLVYEYTLGEEKFTFIEKCNNPRSVTLLVKGPNKHTL
TQIKDAIRDGLRAVKNAIDDGCVVPGAGAVEVALAEALIKYKPSVKGRAQLGVQAFADALLIIP
KVLAQNSGFDLQETLVKVQAEHSESGQLVGVDLNTGEPMVAAEMGVWDNYCVKKQLLHSCTVIA
TNILLVDEIMRAGMSSLKG

hide sequence

Ensembl Acc Id:

ENSRNOP00000001227 ⟸ ENSRNOT00000001227

Ensembl Acc Id:

ENSRNOP00000092130 ⟸ ENSRNOT00000107456

Ensembl Acc Id:

ENSRNOP00000083923 ⟸ ENSRNOT00000107709

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q3MHS9-F1-model_v2	AlphaFold	Q3MHS9	1-531	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698588

Promoter ID:

EPDNEW_R9111

Type:

initiation region

Name:

Cct6a_1

Description:

chaperonin containing TCP1 subunit 6A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	30,501,831 - 30,501,891	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304763	AgrOrtholog
BioCyc Gene	G2FUF-19502	BioCyc
Ensembl Genes	ENSRNOG00000000923	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000001227.8	UniProtKB/TrEMBL
	ENSRNOT00000107456.1	UniProtKB/TrEMBL
	ENSRNOT00000107709	ENTREZGENE
	ENSRNOT00000107709.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.560.10	UniProtKB/TrEMBL
	3.30.260.10	UniProtKB/TrEMBL
	3.50.7.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7300674	IMAGE-MGC_LOAD
	IMAGE:7300985	IMAGE-MGC_LOAD
InterPro	Chap_CCT_zeta	UniProtKB/TrEMBL
	Chaperone_TCP-1	UniProtKB/TrEMBL
	Chaperonin_TCP-1_CS	UniProtKB/TrEMBL
	Cpn60/TCP-1	UniProtKB/TrEMBL
	GroEL-like_apical_dom	UniProtKB/TrEMBL
	GROEL-like_equatorial	UniProtKB/TrEMBL
	TCP-1-like_intermed_sf	UniProtKB/TrEMBL
	TCP-1_chaperonin	UniProtKB/TrEMBL
KEGG Report	rno:288620	UniProtKB/TrEMBL
MGC_CLONE	MGC:109172	IMAGE-MGC_LOAD
	MGC:125121	IMAGE-MGC_LOAD
NCBI Gene	288620	ENTREZGENE
PANTHER	PTHR11353	UniProtKB/TrEMBL
Pfam	Cpn60_TCP1	UniProtKB/TrEMBL
PhenoGen	Cct6a	PhenoGen
PRINTS	TCOMPLEXTCP1	UniProtKB/TrEMBL
PROSITE	TCP1_1	UniProtKB/TrEMBL
	TCP1_2	UniProtKB/TrEMBL
	TCP1_3	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000000923	RatGTEx
Superfamily-SCOP	SSF48592	UniProtKB/TrEMBL
	SSF52029	UniProtKB/TrEMBL
	SSF54849	UniProtKB/TrEMBL
UniProt	A0A8I5ZY35_RAT	UniProtKB/TrEMBL
	A0A8I6ADF8	ENTREZGENE, UniProtKB/TrEMBL
	F7ELS2_RAT	UniProtKB/TrEMBL
	Q3MHS9	ENTREZGENE, UniProtKB/TrEMBL
	Q5BJY2_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-01-13	Cct6a	chaperonin containing TCP1 subunit 6A	Cct6a	chaperonin containing Tcp1, subunit 6A (zeta 1)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-29	Cct6a	chaperonin containing Tcp1, subunit 6A (zeta 1)	Cct6a	chaperonin subunit 6a (zeta)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Cct6a	chaperonin subunit 6a (zeta)	Cct6a_predicted	chaperonin subunit 6a (zeta) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Cct6a_predicted	chaperonin subunit 6a (zeta) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar