Coa8 (cytochrome c oxidase assembly factor 8)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Coa8 (cytochrome c oxidase assembly factor 8) Rattus norvegicus

Analyze

Symbol:

Coa8

Name:

cytochrome c oxidase assembly factor 8

RGD ID:

1304719

Description:

Predicted to be involved in several processes, including mitochondrial cytochrome c oxidase assembly; positive regulation of cytochrome-c oxidase activity; and protein stabilization. Predicted to act upstream of or within intrinsic apoptotic signaling pathway. Predicted to be located in matrix side of mitochondrial inner membrane. Predicted to be active in mitochondrion. Human ortholog(s) of this gene implicated in cytochrome-c oxidase deficiency disease. Orthologous to human COA8 (cytochrome c oxidase assembly factor 8); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

APOP-1; Apop1; Apopt1; apoptogenic 1; apoptogenic 1, mitochondrial; apoptogenic protein 1, mitochondrial; LOC299341; MGC124853; RGD1304719; similar to RIKEN cDNA 2810002N01; UPF0671 protein C14orf153 homolog

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	COA8 (cytochrome c oxidase assembly factor 8)	HGNC	EggNOG, Ensembl, Inparanoid, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Coa8 (cytochrome c oxidase assembly factor 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Apopt1 (apoptogenic 1, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100994669 (cytochrome c oxidase assembly factor 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	COA8 (cytochrome c oxidase assembly factor 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	APOPT1 (apoptogenic 1, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103229762 (cytochrome c oxidase assembly factor 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Apopt1 (apoptogenic 1, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	COA8 (cytochrome c oxidase assembly factor 8)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Coa8 (cytochrome c oxidase assembly factor 8)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	apopt1 (apoptogenic 1, mitochondrial)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG14806	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y39B6A.34	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	130,772,218 - 130,797,081 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	130,771,199 - 130,797,081 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	130,939,429 - 130,964,335 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	6	131,236,399 - 131,261,305 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	6	130,602,427 - 130,627,198 (+)	NCBI	Rnor_WKY
Rnor_6.0	6	136,279,476 - 136,304,317 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0	6	136,185,772 - 136,210,936 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	136,279,496 - 136,304,095 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	6	136,185,487 - 136,210,940 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	144,205,803 - 144,230,967 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	136,495,214 - 136,520,116 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	136,501,406 - 136,526,300 (+)	NCBI
Celera	6	128,327,965 - 128,352,225 (+)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Charcot-Marie-Tooth disease axonal type 2O (ISO)

cytochrome-c oxidase deficiency disease (ISO)

genetic disease (ISO)

Mitochondrial Complex IV Deficiency, Nuclear Type 1 (ISO)

Mitochondrial Complex IV Deficiency, Nuclear Type 17 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

4,4'-sulfonyldiphenol (EXP,ISO)

aflatoxin B1 (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

butan-1-ol (ISO)

cadmium atom (ISO)

carbon nanotube (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

diazinon (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

folic acid (ISO)

fulvestrant (ISO)

gentamycin (EXP)

lead(0) (ISO)

lead(2+) (ISO)

methidathion (ISO)

methyl methanesulfonate (ISO)

sunitinib (ISO)

temozolomide (ISO)

troglitazone (ISO)

tungsten (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

intrinsic apoptotic signaling pathway (IEA,ISO)

mitochondrial cytochrome c oxidase assembly (ISO,ISS)

negative regulation of reactive oxygen species biosynthetic process (ISO,ISS)

positive regulation of cytochrome-c oxidase activity (ISO,ISS)

protein stabilization (ISO,ISS)

response to reactive oxygen species (ISO,ISS)

Cellular Component

matrix side of mitochondrial inner membrane (ISO,ISS)

mitochondrial inner membrane (IEA)

mitochondrion (IBA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:16782708	PMID:18614015	PMID:18977203	PMID:25175347	PMID:30552096

Genomics

Comparative Map Data

Coa8
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	130,772,218 - 130,797,081 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	130,771,199 - 130,797,081 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	130,939,429 - 130,964,335 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	6	131,236,399 - 131,261,305 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	6	130,602,427 - 130,627,198 (+)	NCBI	Rnor_WKY
Rnor_6.0	6	136,279,476 - 136,304,317 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0	6	136,185,772 - 136,210,936 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	136,279,496 - 136,304,095 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	6	136,185,487 - 136,210,940 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	144,205,803 - 144,230,967 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	136,495,214 - 136,520,116 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	136,501,406 - 136,526,300 (+)	NCBI
Celera	6	128,327,965 - 128,352,225 (+)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

COA8
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	103,562,960 - 103,590,899 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	14	103,562,960 - 103,607,523 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	104,029,297 - 104,057,236 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	103,099,084 - 103,128,277 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	103,099,083 - 103,128,261	NCBI
Celera	14	84,083,545 - 84,111,477 (+)	NCBI		Celera
Cytogenetic Map	14	q32.33	NCBI
HuRef	14	84,207,680 - 84,235,763 (+)	NCBI		HuRef
CHM1_1	14	103,967,493 - 103,995,428 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	97,799,005 - 97,826,938 (+)	NCBI		T2T-CHM13v2.0

Coa8
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	111,679,394 - 111,721,491 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	111,679,695 - 111,721,487 (+)	Ensembl		GRCm39 Ensembl
GRCm38	12	111,713,268 - 111,755,057 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	111,713,261 - 111,755,053 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	112,951,480 - 112,993,266 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	112,161,079 - 112,181,999 (+)	NCBI		MGSCv36	mm8
Celera	12	112,907,511 - 112,957,133 (+)	NCBI		Celera
Cytogenetic Map	12	F1	NCBI

Apopt1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955538	2,415,604 - 2,434,658 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955538	2,415,781 - 2,432,742 (+)	NCBI	ChiLan1.0	ChiLan1.0

LOC100994669
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	14	103,938,718 - 103,985,710 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	84,189,323 - 84,217,230 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	104,000,696 - 104,027,230 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	104,000,692 - 104,027,230 (+)	Ensembl	panpan1.1		panPan2

COA8
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	71,324,271 - 71,357,468 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	71,318,244 - 71,357,466 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	70,836,065 - 70,868,225 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	71,600,822 - 71,633,185 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	71,600,828 - 71,632,967 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	71,289,897 - 71,322,193 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	71,329,474 - 71,362,251 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	71,728,858 - 71,761,268 (+)	NCBI		UU_Cfam_GSD_1.0

APOPT1
(Sus scrofa - pig)

No map positions available.

LOC103229762
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	81,503,069 - 81,533,578 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	81,503,134 - 81,535,430 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666053	68,807,395 - 68,837,872 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Apopt1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624734	1,293,851 - 1,315,454 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624734	1,295,053 - 1,315,620 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Coa8
114 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	152
Count of miRNA genes:	117
Interacting mature miRNAs:	127
Transcripts:	ENSRNOT00000015373
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
731173	Uae22	Urinary albumin excretion QTL 22	10.1		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
2290393	Uae37	Urinary albumin excretion QTL 37		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	72202632	130919985	Rat
724513	Uae14	Urinary albumin excretion QTL 14	6.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	85311061	133478515	Rat
1300076	Glom8	Glomerulus QTL 8	7	0.000000009	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	6	86894788	131894788	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	88047916	133047916	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	94968928	137848904	Rat
12801411	Schws8	Schwannoma susceptibility QTL 8			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	94968928	139968928	Rat
8552796	Vie3	Viral induced encephalitis QTL 3	2.6		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	6	96833997	140994061	Rat
1358355	Srcrt4	Stress Responsive Cort QTL 4	6.39		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	100364669	140994061	Rat
2313399	Anxrr28	Anxiety related response QTL 28			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	6	100671796	132340886	Rat
71111	Iddm8	Insulin dependent diabetes mellitus QTL 8	1.9	0.002	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	6	105156861	140994061	Rat
4145118	Mcs26	Mammary carcinoma susceptibility QTL 26		0.0001	mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	6	106752656	132339866	Rat
737976	Pia24	Pristane induced arthritis QTL 24			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	6	112636280	140994061	Rat
1641917	Colcr5	Colorectal carcinoma resistance QTL 5	3.18	0.0009	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	6	122549046	137801795	Rat
2293085	Iddm29	Insulin dependent diabetes mellitus QTL 29	7.66		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	122549046	140286318	Rat
61329	Eae9	Experimental allergic encephalomyelitis QTL 9	3.7		body mass (VT:0001259)	change in body weight (CMO:0002045)	6	122549046	140994061	Rat
2312560	Pur20	Proteinuria QTL 20	2.1	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	125628133	137801795	Rat

Markers in Region

RH134587

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	130,796,769 - 130,796,964 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	136,304,009 - 136,304,203	NCBI	Rnor6.0
Rnor_6.0	6	136,210,625 - 136,210,819	NCBI	Rnor6.0
Rnor_5.0	6	144,205,920 - 144,206,114	UniSTS	Rnor5.0
RGSC_v3.4	6	136,519,805 - 136,519,999	UniSTS	RGSC3.4
Celera	6	128,351,917 - 128,352,111	UniSTS
RH 3.4 Map	6	781.0	UniSTS
Cytogenetic Map	6	q32	UniSTS

AA892746

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	130,784,124 - 130,784,422 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	136,291,365 - 136,291,662	NCBI	Rnor6.0
Rnor_6.0	6	136,197,703 - 136,198,000	NCBI	Rnor6.0
Rnor_5.0	6	144,218,739 - 144,219,036	UniSTS	Rnor5.0
RGSC_v3.4	6	136,507,161 - 136,507,458	UniSTS	RGSC3.4
Celera	6	128,339,449 - 128,339,746	UniSTS
RH 3.4 Map	6	781.1	UniSTS
Cytogenetic Map	6	q32	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	1	2	4	4	2	4			35	20	11	2
Low	2	41	53	37	17	37	8	11	39	15	30	9	8
Below cutoff		1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001037769	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017594513	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017603300	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039112103	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC131885	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC107661	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000169	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000015373 ⟹ ENSRNOP00000015373

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	130,771,199 - 130,797,081 (+)	Ensembl
Rnor_6.0 Ensembl	6	136,185,487 - 136,210,940 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000091946 ⟹ ENSRNOP00000069759

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	130,772,220 - 130,796,197 (+)	Ensembl
Rnor_6.0 Ensembl	6	136,279,496 - 136,304,095 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000103091 ⟹ ENSRNOP00000089878

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	130,772,220 - 130,794,716 (+)	Ensembl

RefSeq Acc Id:

NM_001037769 ⟹ NP_001032858

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	130,772,243 - 130,797,081 (+)	NCBI
Rnor_6.0	6	136,185,772 - 136,210,936 (+)	NCBI
Rnor_5.0	6	144,205,803 - 144,230,967 (-)	NCBI
RGSC_v3.4	6	136,495,214 - 136,520,116 (+)	RGD

Sequence:

show sequence

GTACGCGCGGGCCATGGCGGCTTTGCGGCCCGGAAGCAAAGCTCTTCGCCGGCTGCTCTGCCGG
TCCTTCTCCGGCGGCGGCGTTCGGCTGGCCCGTGAGCGCGCTACGGAGCGCAGGGATGCTGCGT
CCAGCCGGGTCTCAAGATTCTGCCCTCCGAGACAGTCTTGCCATGATTGGATAGGCCCCCCAGA
CAAATACTCCAACCTTCGTCCTGTTCATTTTCATGTCCCTGAAAATGAGTCTCCTTTGGAGCAA
AGGCTTAGGGAATTGAGGCAAGAAACGCAGGAATGGAATCAGCAGTTCTGGGCCAAGCAGAATC
TGTCCTTTAATAAGGAAAAGGAAGAGTTCATTTACTCAAGGCTACAAGCTAAAGGCTCAGGCCC
GCGAACCGAGTCAGGCCAAAGAGCAACGCTGGATGCCGAGGAGATGGCTGACTTCTATAAGGAC
TTTCTGAGCAAGAATTTCCAGAAGCACATGTGCTATAACCGAGACTGGTACAAGCGCAATTTTG
CCATCACTTTCTTCATGGGGAAGGTGGCCCTGGAGAGGATGTGGAGCAAGCTGAAGCAGAAGCC
AAAGAAGACAAGCGGTTAGAGGAGCCCACCGGACCTGACCCACAGCACCAGGTCCATTTACGAG
GCCTGGAAACTAAGTGAGCACAGGTTCCTGACCTGCGCTCAGACCTTTGCTGACTGTGTGTCCC
CAGCGGCTCAGTCCCATCAGCAGACTGTATGCTTGTTGTCTGTATCTTGAATTATGTCAGTTCA
GAAGATAGCAGGGTAAAAATGTGAATAAAGTTTTGCTGTAAGAATTTAATCC

hide sequence

RefSeq Acc Id:

XM_039112103 ⟹ XP_038968031

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	130,772,218 - 130,796,766 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001032858	(Get FASTA)	NCBI Sequence Viewer
	XP_038968031	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI07662	(Get FASTA)	NCBI Sequence Viewer
	EDL97453	(Get FASTA)	NCBI Sequence Viewer
	Q32Q90	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001032858 ⟸ NM_001037769
- UniProtKB:	Q32Q90 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MAALRPGSKALRRLLCRSFSGGGVRLARERATERRDAASSRVSRFCPPRQSCHDWIGPPDKYSN LRPVHFHVPENESPLEQRLRELRQETQEWNQQFWAKQNLSFNKEKEEFIYSRLQAKGSGPRTES GQRATLDAEEMADFYKDFLSKNFQKHMCYNRDWYKRNFAITFFMGKVALERMWSKLKQKPKKTS G hide sequence

RefSeq Acc Id:

ENSRNOP00000069759 ⟸ ENSRNOT00000091946

RefSeq Acc Id:

ENSRNOP00000015373 ⟸ ENSRNOT00000015373

RefSeq Acc Id:	XP_038968031 ⟸ XM_039112103
- Peptide Label:	isoform X1

RefSeq Acc Id:

ENSRNOP00000089878 ⟸ ENSRNOT00000103091

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q32Q90-F1-model_v2	AlphaFold	Q32Q90	1-193	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694844

Promoter ID:

EPDNEW_R5369

Type:

initiation region

Name:

Apopt1_1

Description:

apoptogenic 1, mitochondrial

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	136,279,483 - 136,279,543	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304719	AgrOrtholog
BioCyc Gene	G2FUF-35828	BioCyc
Ensembl Genes	ENSRNOG00000011542	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00000058920	Ensembl
Ensembl Protein	ENSRNOP00000015373.5	UniProtKB/TrEMBL
	ENSRNOP00000069759.2	UniProtKB/TrEMBL
	ENSRNOP00000089878.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000015373.7	UniProtKB/TrEMBL
	ENSRNOT00000091946.2	UniProtKB/TrEMBL
	ENSRNOT00000103091.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7936717	IMAGE-MGC_LOAD
InterPro	APOPT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:299341	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:124853	IMAGE-MGC_LOAD
NCBI Gene	299341	ENTREZGENE
PANTHER	CYTOCHROME C OXIDASE ASSEMBLY FACTOR 8	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR31107	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	DUF2315	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Coa8	PhenoGen
UniProt	A0A8I6AB95_RAT	UniProtKB/TrEMBL
	A0A8L2Q7C7_RAT	UniProtKB/TrEMBL
	A0A8L2R305_RAT	UniProtKB/TrEMBL
	APOP1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-04-29	Coa8	cytochrome c oxidase assembly factor 8	Apopt1	apoptogenic 1, mitochondrial	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-13	Apopt1	apoptogenic 1, mitochondrial	Apopt1	apoptogenic 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-09-29	Apopt1	apoptogenic 1	RGD1304719	similar to RIKEN cDNA 2810002N01	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1304719	similar to RIKEN cDNA 2810002N01	RGD1304719_predicted	similar to RIKEN cDNA 2810002N01 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1304719_predicted	similar to RIKEN cDNA 2810002N01 (predicted)	LOC299341_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC299341_predicted	similar to RIKEN cDNA 2810002N01 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM