Amdhd2 (amidohydrolase domain containing 2)

Advanced Search (OLGA)

Gene: Amdhd2 (amidohydrolase domain containing 2) Rattus norvegicus

Analyze

Symbol:

Amdhd2

Name:

amidohydrolase domain containing 2

RGD ID:

1304601

Description:

Predicted to enable N-acetylglucosamine-6-phosphate deacetylase activity. Predicted to be involved in N-acetylglucosamine catabolic process and negative regulation of UDP-N-acetylglucosamine biosynthetic process. Orthologous to human AMDHD2 (amidohydrolase domain containing 2); PARTICIPATES IN amino sugar metabolic pathway; french type sialuria pathway; sialic acid storage disease pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

amidohydrolase domain-containing protein 2; glcNAc 6-P deacetylase; LOC302972; MGC109150; N-acetylglucosamine-6-phosphate deacetylase; putative N-acetylglucosamine-6-phosphate deacetylase; RGD1304601; similar to RIKEN cDNA 5730457F11

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	AMDHD2 (amidohydrolase domain containing 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Amdhd2 (amidohydrolase domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Amdhd2 (amidohydrolase domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	AMDHD2 (amidohydrolase domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	AMDHD2 (amidohydrolase domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	AMDHD2 (amidohydrolase domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	AMDHD2 (amidohydrolase domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Amdhd2 (amidohydrolase domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	HEATR9 (HEAT repeat containing 9)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Amdhd2 (amidohydrolase domain containing 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	AMDHD2 (amidohydrolase domain containing 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	amdhd2 (amidohydrolase domain containing 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG17065	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F59B2.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	amdhd2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	13,692,136 - 13,700,632 (-)	NCBI		GRCr8
mRatBN7.2	10	13,187,579 - 13,196,148 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	13,187,578 - 13,196,095 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	17,932,403 - 17,940,891 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	17,421,240 - 17,429,728 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	12,919,718 - 12,928,192 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	13,528,400 - 13,536,949 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	13,528,413 - 13,536,899 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	13,344,252 - 13,352,913 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	13,407,051 - 13,415,537 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	13,407,050 - 13,415,527 (-)	NCBI
Celera	10	12,873,632 - 12,882,118 (-)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

developmental and epileptic encephalopathy 1 (ISO)

epilepsy (ISO)

idiopathic generalized epilepsy (ISO)

short-rib thoracic dysplasia 9 with or without polydactyly (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

acrylamide (ISO)

alpha-pinene (ISO)

amitrole (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

azoxystrobin (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

clofibrate (ISO)

copper(II) sulfate (ISO)

deguelin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

folic acid (ISO)

folpet (ISO)

gentamycin (EXP)

indole-3-methanol (EXP)

inulin (ISO)

lidocaine (EXP)

methamphetamine (EXP)

methapyrilene (ISO)

methimazole (EXP)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

picoxystrobin (ISO)

pirinixic acid (ISO)

propiconazole (EXP)

pyrimidifen (ISO)

rotenone (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

sulfadimethoxine (EXP)

tetraphene (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

trovafloxacin (ISO)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

N-acetylglucosamine catabolic process (IBA)

N-acetylglucosamine metabolic process (IEA)

N-acetylneuraminate catabolic process (IEA)

negative regulation of UDP-N-acetylglucosamine biosynthetic process (IEA,ISO)

Molecular Function

metal ion binding (IEA)

N-acetylgalactosamine-6-phosphate deacetylase activity (IEA,ISO)

N-acetylglucosamine-6-phosphate deacetylase activity (IBA,IEA,ISO,ISS)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

amino sugar metabolic pathway (IEA,ISO)

french type sialuria pathway (ISO)

nucleotide sugar metabolic pathway (IEA)

sialic acid storage disease pathway (ISO)

Tay-Sachs disease pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:21630459	PMID:22692205

Genomics

Comparative Map Data

Amdhd2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	13,692,136 - 13,700,632 (-)	NCBI		GRCr8
mRatBN7.2	10	13,187,579 - 13,196,148 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	13,187,578 - 13,196,095 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	17,932,403 - 17,940,891 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	17,421,240 - 17,429,728 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	12,919,718 - 12,928,192 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	13,528,400 - 13,536,949 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	13,528,413 - 13,536,899 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	13,344,252 - 13,352,913 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	13,407,051 - 13,415,537 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	13,407,050 - 13,415,527 (-)	NCBI
Celera	10	12,873,632 - 12,882,118 (-)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

AMDHD2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	2,520,371 - 2,531,417 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	2,520,357 - 2,531,422 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	2,570,372 - 2,581,418 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	2,510,428 - 2,519,733 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	16	2,785,299 - 2,795,891 (+)	NCBI		Celera
Cytogenetic Map	16	p13.3	NCBI
HuRef	16	2,496,333 - 2,507,027 (+)	NCBI		HuRef
CHM1_1	16	2,570,312 - 2,580,904 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	2,542,493 - 2,553,539 (+)	NCBI		T2T-CHM13v2.0

Amdhd2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	24,374,807 - 24,382,752 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	24,374,807 - 24,382,740 (-)	Ensembl		GRCm39 Ensembl
GRCm38	17	24,155,833 - 24,163,733 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	24,155,833 - 24,163,766 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	24,292,800 - 24,300,700 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	23,883,455 - 23,891,359 (-)	NCBI		MGSCv36	mm8
Celera	17	24,661,114 - 24,669,067 (-)	NCBI		Celera
Cytogenetic Map	17	A3.3	NCBI
cM Map	17	12.28	NCBI

Amdhd2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955442	14,782,755 - 14,791,649 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955442	14,775,528 - 14,791,650 (-)	NCBI	ChiLan1.0	ChiLan1.0

AMDHD2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	3,022,005 - 3,032,992 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	6,803,011 - 6,813,986 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	1,376,904 - 1,387,883 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	2,619,320 - 2,629,347 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	2,619,320 - 2,630,375 (+)	Ensembl	panpan1.1		panPan2

AMDHD2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	38,509,793 - 38,519,711 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	39,748,187 - 39,758,083 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	38,819,036 - 38,828,935 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	38,819,043 - 38,830,163 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	38,504,196 - 38,514,092 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	38,476,804 - 38,486,701 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	38,952,889 - 38,962,784 (-)	NCBI		UU_Cfam_GSD_1.0

AMDHD2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	39,522,163 - 39,532,995 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	39,523,076 - 39,532,590 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	42,706,973 - 42,716,475 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

AMDHD2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	2,394,229 - 2,403,949 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	2,394,295 - 2,405,897 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666068	28,619,426 - 28,630,811 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Amdhd2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624824	271,884 - 282,866 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624824	273,036 - 282,866 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Amdhd2
26 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	127
Count of miRNA genes:	100
Interacting mature miRNAs:	105
Transcripts:	ENSRNOT00000008537
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
631660	Hcar1	Hepatocarcinoma resistance QTL 1	3.4	0.0001	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	10	6154182	15990232	Rat
1576304	Schws7	Schwannoma susceptibility QTL 7		0.0115	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	4765527	19816042	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	1	24158324	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35225947	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
737820	Alc9	Alcohol consumption QTL 9	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	5144027	19233348	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
631828	Alc5	Alcohol consumption QTL 5	2.4		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	5144027	17245662	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38328221	Rat

Markers in Region

Atp6l

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	13,196,216 - 13,196,379 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	13,537,044 - 13,537,206	NCBI	Rnor6.0
Rnor_5.0	10	13,353,004 - 13,353,166	UniSTS	Rnor5.0
RGSC_v3.4	10	13,415,682 - 13,415,844	UniSTS	RGSC3.4
Celera	10	12,882,263 - 12,882,425	UniSTS
Cytogenetic Map	10	q12	UniSTS

RH135105

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	13,191,880 - 13,192,086 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	13,532,705 - 13,532,910	NCBI	Rnor6.0
Rnor_5.0	10	13,348,544 - 13,348,870	UniSTS	Rnor5.0
Rnor_5.0	10	13,348,544 - 13,348,749	UniSTS	Rnor5.0
RGSC_v3.4	10	13,411,343 - 13,411,548	UniSTS	RGSC3.4
Celera	10	12,877,924 - 12,878,129	UniSTS
RH 3.4 Map	10	191.3	UniSTS
Cytogenetic Map	10	q12	UniSTS

BI274660

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	13,187,668 - 13,187,818 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	13,528,493 - 13,528,642	NCBI	Rnor6.0
Rnor_5.0	10	13,344,332 - 13,344,481	UniSTS	Rnor5.0
RGSC_v3.4	10	13,407,131 - 13,407,280	UniSTS	RGSC3.4
Celera	10	12,873,712 - 12,873,861	UniSTS
Cytogenetic Map	10	q12	UniSTS

Atp6c3

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	13,196,216 - 13,196,405 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	13,537,044 - 13,537,232	NCBI	Rnor6.0
Rnor_5.0	10	13,353,004 - 13,353,192	UniSTS	Rnor5.0
RGSC_v3.4	10	13,415,682 - 13,415,870	UniSTS	RGSC3.4
Celera	10	12,882,263 - 12,882,451	UniSTS
Cytogenetic Map	10	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001024990	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008767565	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085857	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC098526	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC091278	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CO388545	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000008537 ⟹ ENSRNOP00000008537

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	13,187,587 - 13,196,095 (-)	Ensembl
Rnor_6.0 Ensembl	10	13,528,413 - 13,536,899 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097046 ⟹ ENSRNOP00000085897

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	13,187,593 - 13,196,062 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101639 ⟹ ENSRNOP00000086057

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	13,187,578 - 13,196,082 (-)	Ensembl

RefSeq Acc Id:

NM_001024990 ⟹ NP_001020161

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	13,692,146 - 13,700,632 (-)	NCBI
mRatBN7.2	10	13,187,589 - 13,196,072 (-)	NCBI
Rnor_6.0	10	13,528,413 - 13,536,899 (-)	NCBI
Rnor_5.0	10	13,344,252 - 13,352,913 (-)	NCBI
RGSC_v3.4	10	13,407,051 - 13,415,537 (-)	RGD
Celera	10	12,873,632 - 12,882,118 (-)	RGD

Sequence:

show sequence

GGCCGGCTTCCGATTACCACTGCTCCGGGCACTGCCGGCCTGCGCCCAAAGGGTTCAGCGCGAC
TCACGATGCGTAGCGGGCAGTCCGCAGCGTTGGCTCCCGTGCTCCAGTTCACCAACTGCCGCAT
CCTGCGCGGCGGCACGCTGCTCAGGGAGGATCTGTGGGTGCGCGGGGGCCGAATCCTGGACCCA
GAGAAGCTGTTTTTTGAGGAGAGGCGTGTGGCTGATGAGCAGCGGGACTGCGGAGGCCGCATCC
TGGCGCCGGGCTTTATCGATGTGCAGATCAACGGTGGATTTGGTGTTGACTTCTCCAGGGCCAC
GGAGGACGTGGGTTCGGGGGTCGCCCTAGTGGCCCGGAGGCTCCTGTCCCACGGTGTCACCTCC
TTCTGTCCCACCCTGGTGACCTCCCCACCAGAGGTTTATCACAAGGTCCTTCCTCAGATCCCTG
TGAAGAGTGGAGGTCCCCATGGGGCAGGGGTCCTCGGGGTGCACTTGGAAGGCCCGTTCATCAG
CCGGGAAAAGCGGGGTGCACACCCTGAGGCCTACCTCCGCTCCTTTGGAGCCAATGCTTTTCAT
GACGTGTTGGCCACGTACGGTCCCCTGGACAACGTCTGCATTGTGACACTTGCCCCTGAACTAG
ACCGGAGCCATGAGGTGATCCAGGCACTGACAGCCAAAGGCATCCGTGTATCTCTGGGGCACTC
GGTGGCTGACCTGCGGGCTGCAGAAGTAGCAGTGCAGAGTGGGGCCACCTTCATCACTCACCTC
TTCAACGCCATGTTGCCTTTCCACCACCGTGACCCAGGCATAGTAGGGCTTCTGACCAGTGACC
AGCTGCCCCCAGGCCACTGTATCTTCTATGGGATGATTGCCGATGGCATACACACTAACCCTGC
AGCCCTGCGCATTGCTCACCGGGCCCATCCCCAGGGGCTGGTGCTGGTCACTGATGCTGTCCCT
GCCCTGGGCTTGGGCAATGGCCGCCACACGCTGGGACAGCAAGAGGTGGAGGTAGATGGGCTCA
TAGCCTACATTGCAGGCACCAAGACGCTAAGTGGCAGCATAGCCCCGATGGATGTTTGCATCCG
GCATTTCCTGCAGGCTACAGGCTGTAGTGTGGAGTCGGCTCTGGAAGCTGCATCCCTCCACCCC
GCCCAGCTGCTGGGGCTGGAGAAGACCAAGGGGAGTCTGGACTTTGGTGCTGATGCAGACTTTG
TGGTGCTCGACGACACTCTCCATGTCCAGGCCACTTACATCTCTGGTGAACTGGTGTGGCAGGC
AGAGGAAGCTGGGCTGTGACTGAGGGTCTTGGCTGGAAAGGACATTTGGCTCCAGCTGGACAGT
GACAGGCCGGGCAGTCCATGGAGCTGGTCTCCAAGGAGGAAGCTGAGAGCCCTGCTCCATGTCT
AACCTCAGTCATCACTTCTGGAGGGGAGGCAGTGGCCTGGATAAATACAGACAGCGGGACTTGC
AAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039085857 ⟹ XP_038941785

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	13,692,136 - 13,700,615 (-)	NCBI
mRatBN7.2	10	13,187,579 - 13,196,148 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001020161	(Get FASTA)	NCBI Sequence Viewer
	XP_038941785	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM03807	(Get FASTA)	NCBI Sequence Viewer
	EDM03808	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000008537.6
	ENSRNOP00000085897.1
	ENSRNOP00000086057.1
	ENSRNOP00055037458
	ENSRNOP00060013052
	ENSRNOP00065012621
GenBank Protein	Q5BJY6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001020161 ⟸ NM_001024990

- UniProtKB:

Q5BJY6 (UniProtKB/Swiss-Prot), A6HCQ3 (UniProtKB/TrEMBL), A0A8I6A4U1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRSGQSAALAPVLQFTNCRILRGGTLLREDLWVRGGRILDPEKLFFEERRVADEQRDCGGRILA
PGFIDVQINGGFGVDFSRATEDVGSGVALVARRLLSHGVTSFCPTLVTSPPEVYHKVLPQIPVK
SGGPHGAGVLGVHLEGPFISREKRGAHPEAYLRSFGANAFHDVLATYGPLDNVCIVTLAPELDR
SHEVIQALTAKGIRVSLGHSVADLRAAEVAVQSGATFITHLFNAMLPFHHRDPGIVGLLTSDQL
PPGHCIFYGMIADGIHTNPAALRIAHRAHPQGLVLVTDAVPALGLGNGRHTLGQQEVEVDGLIA
YIAGTKTLSGSIAPMDVCIRHFLQATGCSVESALEAASLHPAQLLGLEKTKGSLDFGADADFVV
LDDTLHVQATYISGELVWQAEEAGL

hide sequence

Ensembl Acc Id:

ENSRNOP00000008537 ⟸ ENSRNOT00000008537

RefSeq Acc Id:	XP_038941785 ⟸ XM_039085857
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2Q3B7 (UniProtKB/TrEMBL), A0A8I6A4U1 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000085897 ⟸ ENSRNOT00000097046

Ensembl Acc Id:

ENSRNOP00000086057 ⟸ ENSRNOT00000101639

Protein Domains

Amidohydrolase-related

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5BJY6-F1-model_v2	AlphaFold	Q5BJY6	1-409	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697003

Promoter ID:

EPDNEW_R7528

Type:

initiation region

Name:

Amdhd2_1

Description:

amidohydrolase domain containing 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	13,536,869 - 13,536,929	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304601	AgrOrtholog
BioCyc Gene	G2FUF-25876	BioCyc
BioCyc Pathway	GLUAMCAT-PWY [N-acetylglucosamine degradation I]	BioCyc
BioCyc Pathway Image	GLUAMCAT-PWY	BioCyc
Ensembl Genes	ENSRNOG00000006460	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00055026495	UniProtKB/Swiss-Prot
	ENSRNOG00060009895	UniProtKB/Swiss-Prot
	ENSRNOG00065010271	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000008537.6	UniProtKB/TrEMBL
	ENSRNOT00000097046.1	UniProtKB/TrEMBL
	ENSRNOT00000101639.1	UniProtKB/TrEMBL
	ENSRNOT00055045708	UniProtKB/Swiss-Prot
	ENSRNOT00060016702	UniProtKB/Swiss-Prot
	ENSRNOT00065016578	UniProtKB/Swiss-Prot
Gene3D-CATH	2.30.40.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Metal-dependent hydrolases	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7384067	IMAGE-MGC_LOAD
InterPro	Amidohydro-rel	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GlcNAc_6-P_deAcase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Metal-dep_hydrolase_composite	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Metal_Hydrolase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:302972	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:109150	IMAGE-MGC_LOAD
NCBI Gene	302972	ENTREZGENE
PANTHER	N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11113:SF14	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Amidohydro_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Amdhd2	PhenoGen
PIRSF	NagA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000006460	RatGTEx
	ENSRNOG00055026495	RatGTEx
	ENSRNOG00060009895	RatGTEx
	ENSRNOG00065010271	RatGTEx
Superfamily-SCOP	SSF51338	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF51556	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6A4U1	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A5A8_RAT	UniProtKB/TrEMBL
	A0A8L2Q3B7	ENTREZGENE, UniProtKB/TrEMBL
	A6HCQ3	ENTREZGENE, UniProtKB/TrEMBL
	NAGA_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-04	Amdhd2	amidohydrolase domain containing 2	RGD1304601	similar to RIKEN cDNA 5730457F11	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1304601	similar to RIKEN cDNA 5730457F11	RGD1304601_predicted	similar to RIKEN cDNA 5730457F11 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1304601_predicted	similar to RIKEN cDNA 5730457F11 (predicted)	LOC302972_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC302972_predicted	similar to RIKEN cDNA 5730457F11 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways