Wnt6 (Wnt family member 6) - Rat Genome Database

Name: Wnt6
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Wnt6 (Wnt family member 6) Rattus norvegicus

Analyze

Symbol:

Wnt6

Name:

Wnt family member 6

RGD ID:

1304559

Description:

Predicted to enable cytokine activity and frizzled binding activity. Predicted to be involved in several processes, including canonical Wnt signaling pathway; odontogenesis of dentin-containing tooth; and positive regulation of tooth mineralization. Predicted to act upstream of or within several processes, including epithelial-mesenchymal cell signaling; nephron tubule morphogenesis; and positive regulation of macromolecule biosynthetic process. Predicted to be located in cell surface and extracellular matrix. Predicted to be active in extracellular space. Orthologous to human WNT6 (Wnt family member 6); PARTICIPATES IN Wnt signaling pathway; Wnt signaling, canonical pathway; basal cell carcinoma pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC316526; protein Wnt-6; wingless-related MMTV integration site 6; wingless-type MMTV integration site family, member 6

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	WNT6 (Wnt family member 6)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Wnt6 (wingless-type MMTV integration site family, member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Wnt6 (Wnt family member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	WNT6 (Wnt family member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	WNT6 (Wnt family member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Wnt6 (Wnt family member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	WNT6 (Wnt family member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	WNT6 (Wnt family member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Wnt6 (Wnt family member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	WNT6 (Wnt family member 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Wnt6 (wingless-type MMTV integration site family, member 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	wnt6b (wingless-type MMTV integration site family, member 6b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Wnt6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	9	76,329,882 - 76,343,523 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	76,329,882 - 76,343,523 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	84,775,108 - 84,788,700 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	89,904,052 - 89,917,640 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	88,290,221 - 88,303,815 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	82,033,543 - 82,047,172 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	82,033,543 - 82,047,166 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	81,796,069 - 81,809,700 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	74,104,364 - 74,117,995 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	74,260,929 - 74,264,251 (+)	NCBI
Celera	9	73,902,364 - 73,915,999 (+)	NCBI		Celera
Cytogenetic Map	9	q33	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

alacrima, achalasia, and impaired intellectual development syndrome (ISO)

Animal Mammary Neoplasms (ISO)

bladder exstrophy-epispadias-cloacal exstrophy complex (ISO)

cerebrotendinous xanthomatosis (ISO)

Experimental Mammary Neoplasms (ISO)

genetic disease (ISO)

myofibrillar myopathy 1 (ISO)

Neurodevelopmental Disorders (ISO)

paroxysmal nonkinesigenic dyskinesia 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxynon-2-enal (ISO)

6-propyl-2-thiouracil (EXP)

all-trans-retinoic acid (ISO)

amitrole (EXP)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbaryl (ISO)

celastrol (ISO)

CGP 52608 (ISO)

dextran sulfate (ISO)

diazinon (EXP)

dibutyl phthalate (EXP,ISO)

dieldrin (EXP)

diethyl phthalate (EXP)

diisobutyl phthalate (EXP)

diisononyl phthalate (EXP)

dinophysistoxin 1 (ISO)

dorsomorphin (ISO)

fenvalerate (EXP)

folic acid (ISO)

formaldehyde (ISO)

genistein (ISO)

hydrogen peroxide (ISO)

lipopolysaccharide (ISO)

manganese(II) chloride (EXP)

mercury dibromide (ISO)

methimazole (EXP)

N-methyl-4-phenylpyridinium (EXP)

nickel atom (EXP)

O-methyleugenol (ISO)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

propanal (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sulforaphane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichostatin A (ISO)

triclosan (ISO)

triptonide (ISO)

valproic acid (EXP,ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

axis specification (ISO)

biological_process (ND)

branching involved in ureteric bud morphogenesis (ISO)

canonical Wnt signaling pathway (IBA)

cell fate commitment (IBA)

epithelial-mesenchymal cell signaling (ISO)

nephron tubule development (ISO)

nephron tubule formation (ISO)

neuron differentiation (IBA)

odontogenesis of dentin-containing tooth (ISO)

positive regulation of DNA-templated transcription (ISO)

positive regulation of gene expression (ISO)

positive regulation of tooth mineralization (ISO)

Wnt signaling pathway (ISO)

Cellular Component

cell surface (ISO)

extracellular matrix (ISO)

extracellular space (IBA)

membrane (IEA)

Molecular Function

cytokine activity (IBA)

frizzled binding (IBA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

basal cell carcinoma pathway (IEA)

Hedgehog signaling pathway (IEA)

Wnt signaling pathway (IEA,ISO)

Wnt signaling, canonical pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Adenomyoepitheliomatous lesions of the mammary glands in transgenic mice with targeted PLAG1 overexpression.	Declercq J, etal., Int J Cancer. 2008 Jul 22.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Identification and characterization of rat Wnt6 and Wnt10a genes in silico.	Katoh Y and Katoh M, Int J Mol Med 2005 Mar;15(3):527-31.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Comprehensive gene review and curation	RGD comprehensive gene curation
11.	The Wnt Homepage	Roel Nusse - Howard Hughes Medical Institute and the Department of Developmental Biology at Stanford University, California, USA
12.	Transformation by Wnt family proteins correlates with regulation of beta-catenin.	Shimizu H, etal., Cell Growth Differ. 1997 Dec;8(12):1349-58.
13.	Alternative wnt signaling is initiated by distinct receptors.	van Amerongen R, etal., Sci Signal. 2008 Sep 2;1(35):re9.
14.	Differential transformation of mammary epithelial cells by Wnt genes.	Wong GT, etal., Mol Cell Biol. 1994 Sep;14(9):6278-86.

Additional References at PubMed

PMID:8167409	PMID:9356179	PMID:11948913	PMID:11973284	PMID:20113781

Genomics

Comparative Map Data

Wnt6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	9	76,329,882 - 76,343,523 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	76,329,882 - 76,343,523 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	84,775,108 - 84,788,700 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	89,904,052 - 89,917,640 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	88,290,221 - 88,303,815 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	82,033,543 - 82,047,172 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	82,033,543 - 82,047,166 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	81,796,069 - 81,809,700 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	74,104,364 - 74,117,995 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	74,260,929 - 74,264,251 (+)	NCBI
Celera	9	73,902,364 - 73,915,999 (+)	NCBI		Celera
Cytogenetic Map	9	q33	NCBI

WNT6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	218,859,805 - 218,874,233 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	218,859,805 - 218,874,233 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	219,724,528 - 219,738,955 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	219,432,790 - 219,447,198 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	219,550,050 - 219,564,459	NCBI
Celera	2	213,494,308 - 213,508,717 (+)	NCBI		Celera
Cytogenetic Map	2	q35	NCBI
HuRef	2	211,579,073 - 211,593,483 (+)	NCBI		HuRef
CHM1_1	2	219,731,923 - 219,746,333 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	219,348,208 - 219,362,636 (+)	NCBI		T2T-CHM13v2.0

Wnt6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	74,793,499 - 74,824,481 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	74,811,051 - 74,824,481 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	74,754,342 - 74,785,322 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	74,771,892 - 74,785,322 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	74,818,466 - 74,831,893 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	74,705,165 - 74,718,155 (+)	NCBI		MGSCv36	mm8
Celera	1	75,326,979 - 75,340,389 (+)	NCBI		Celera
Cytogenetic Map	1	C4	NCBI
cM Map	1	38.54	NCBI

Wnt6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955453	14,545,700 - 14,560,976 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955453	14,547,427 - 14,560,001 (-)	NCBI	ChiLan1.0	ChiLan1.0

WNT6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	2B	121,507,573 - 121,522,558 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	106,119,740 - 106,134,317 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	224,714,217 - 224,728,557 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	224,714,229 - 224,728,171 (+)	Ensembl	panpan1.1		panPan2

WNT6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	37	25,452,875 - 25,457,437 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	37	25,453,905 - 25,456,654 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	37	26,264,174 - 26,277,672 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	37	25,459,418 - 25,472,890 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	37	25,459,276 - 25,472,463 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	37	25,364,055 - 25,377,524 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	37	25,298,852 - 25,312,297 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	37	25,319,631 - 25,333,316 (+)	NCBI		UU_Cfam_GSD_1.0

Wnt6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	174,947,277 - 174,959,904 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936569	1,290,052 - 1,302,691 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936569	1,290,061 - 1,302,672 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

WNT6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	120,901,376 - 120,917,486 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	120,901,471 - 120,917,359 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

WNT6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	104,759,794 - 104,775,642 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	104,760,045 - 104,774,487 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	94,626,733 - 94,641,426 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Wnt6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624823	6,145,545 - 6,150,181 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624823	6,145,836 - 6,150,133 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Wnt6
55 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	323
Count of miRNA genes:	195
Interacting mature miRNAs:	236
Transcripts:	ENSRNOT00000023439
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10054125	Srcrt7	Stress Responsive Cort QTL 7	3.33	0.0011	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	9	1	87073594	Rat
70186	Niddm26	Non-insulin dependent diabetes mellitus QTL 26	3.87		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	9	22071169	86369743	Rat
7207814	Bmd91	Bone mineral density QTL 91	3.5		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	9	23754144	83851531	Rat
70218	Cm28	Cardiac mass QTL 28	8.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	25268044	79271759	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	25268044	114175309	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	25661188	100929786	Rat
7411656	Foco26	Food consumption QTL 26	9.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	32535505	77535505	Rat
7411571	Bw138	Body weight QTL 138	14.3	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	9	32535505	77535505	Rat
1598834	Memor11	Memory QTL 11	2.5		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	9	36962359	77814038	Rat
8662828	Vetf6	Vascular elastic tissue fragility QTL 6	3.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	9	36962359	92058970	Rat
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	36962359	95410867	Rat
6903941	Pur31	Proteinuria QTL 31		0.036	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	9	40194188	85194188	Rat
11353949	Bp393	Blood pressure QTL 393			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	40194188	85194188	Rat
61352	Bp34	Blood pressure QTL 34	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	42495343	79271511	Rat
10058949	Gmadr5	Adrenal mass QTL 5	2	0.014	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	9	42791513	87976209	Rat
11353951	Bp394	Blood pressure QTL 394			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	44649921	89649921	Rat
12879506	Pur33	Proteinuria QTL 33			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	44649921	89649921	Rat
11353957	Bmd92	Bone mineral density QTL 92		0.01	tibia mineral mass (VT:1000283)	volumetric bone mineral density (CMO:0001553)	9	46114199	91114199	Rat
631656	Bp108	Blood pressure QTL 108	5.97	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	48598251	93598251	Rat
2303170	Bp332	Blood pressure QTL 332	3.73	0.027	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	55847841	77026453	Rat
2303180	Bp333	Blood pressure QTL 333		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	56627713	78595166	Rat
2303180	Bp333	Blood pressure QTL 333		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	9	56627713	78595166	Rat
2303180	Bp333	Blood pressure QTL 333		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	56627713	78595166	Rat
1578760	Cm53	Cardiac mass QTL 53	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	56771635	101771635	Rat
724515	Uae16	Urinary albumin excretion QTL 16	8		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	58163035	100929646	Rat
1300134	Bp185	Blood pressure QTL 185	3.73		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	61381434	104821652	Rat
1581580	Uae34	Urinary albumin excretion QTL 34			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	62072275	96470995	Rat
1578757	Pur6	Proteinuria QTL 6	3.3	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	62072275	96470995	Rat
61385	Edpm9	Estrogen-dependent pituitary mass QTL 9	3.43	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	63869687	108869687	Rat
731171	Glom6	Glomerulus QTL 6	2.8	0.0003	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	9	64573531	109573531	Rat
1354626	Bvd1	Brain ventricular dilatation QTL 1	3.73	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	9	75712843	111552878	Rat

Markers in Region

RH144667

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	76,331,588 - 76,331,751 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	82,035,243 - 82,035,405	NCBI	Rnor6.0
Rnor_5.0	9	81,797,769 - 81,797,931	UniSTS	Rnor5.0
RGSC_v3.4	9	74,106,064 - 74,106,226	UniSTS	RGSC3.4
Celera	9	73,904,064 - 73,904,226	UniSTS
RH 3.4 Map	9	768.69	UniSTS
Cytogenetic Map	9	q33	UniSTS

Wnt6

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	76,342,486 - 76,343,129 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	82,046,136 - 82,046,778	NCBI	Rnor6.0
Rnor_5.0	9	81,808,664 - 81,809,306	UniSTS	Rnor5.0
RGSC_v3.4	9	74,116,959 - 74,117,601	UniSTS	RGSC3.4
Celera	9	73,914,963 - 73,915,605	UniSTS
Cytogenetic Map	9	q33	UniSTS

M89800

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	76,342,927 - 76,343,136 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	82,046,577 - 82,046,785	NCBI	Rnor6.0
Rnor_5.0	9	81,809,105 - 81,809,313	UniSTS	Rnor5.0
RGSC_v3.4	9	74,117,400 - 74,117,608	UniSTS	RGSC3.4
Celera	9	73,915,404 - 73,915,612	UniSTS
Cytogenetic Map	9	q33	UniSTS

UniSTS:471328

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	76,340,300 - 76,340,672 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	82,043,950 - 82,044,321	NCBI	Rnor6.0
Rnor_5.0	9	81,806,476 - 81,806,847	UniSTS	Rnor5.0
RGSC_v3.4	9	74,114,771 - 74,115,142	UniSTS	RGSC3.4
Celera	9	73,912,777 - 73,913,148	UniSTS
Cytogenetic Map	9	q33	UniSTS

Wnt6

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	76,340,725 - 76,340,964 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	82,044,375 - 82,044,613	NCBI	Rnor6.0
Rnor_5.0	9	81,806,901 - 81,807,139	UniSTS	Rnor5.0
RGSC_v3.4	9	74,115,196 - 74,115,434	UniSTS	RGSC3.4
Celera	9	73,913,202 - 73,913,440	UniSTS
Cytogenetic Map	9	q33	UniSTS

Wnt6

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	76,342,354 - 76,342,731 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	82,046,004 - 82,046,380	NCBI	Rnor6.0
Rnor_5.0	9	81,808,532 - 81,808,908	UniSTS	Rnor5.0
RGSC_v3.4	9	74,116,827 - 74,117,203	UniSTS	RGSC3.4
Celera	9	73,914,831 - 73,915,207	UniSTS
Cytogenetic Map	9	q33	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium											30
Low		2	11		14		1	1	60	16	10	1	1
Below cutoff	3	27	21	16	5	16	7	10	10	17	1	10	7

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108226	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC132020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000215	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000023439 ⟹ ENSRNOP00000023439

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	76,329,882 - 76,343,523 (+)	Ensembl
Rnor_6.0 Ensembl	9	82,033,543 - 82,047,166 (+)	Ensembl

RefSeq Acc Id:

NM_001108226 ⟹ NP_001101696

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	9	76,329,882 - 76,343,523 (+)	NCBI
Rnor_6.0	9	82,033,543 - 82,047,172 (+)	NCBI
Rnor_5.0	9	81,796,069 - 81,809,700 (+)	NCBI
RGSC_v3.4	9	74,104,364 - 74,117,995 (+)	RGD
Celera	9	73,902,364 - 73,915,999 (+)	RGD

Sequence:

show sequence

TGATTTCTTCTCTCCAGCGAGCTCCGCAGGAGACACAGGCGCTGGCTGCTGGGTCCGCTCTCCG
CCTCCGCCGCGCCCTCCTCGCCCGGGATGGGCCCCCCCGCCGCCACCGCCGCCGGAGCTCTAGT
CTCCCGGCCGCCGCCTCGGTCGCCGCGTTTGCCTTGAAGCCCGGTGCCGGCGCTCCCCGGCTCA
CCCCGCAGCCTTACTCCCCCGCGCCAGACTGCGGGAGAGCTCTCAGGATGCTGCCGCCGGTGCC
CTCCTGCCTCGGACTGCTGCTGCTGCTGCTCTTGTGCCCTGCGCACGTCGGTGGACTGTGGTGG
GCCGTGGGCAGCCCCCTGGTCATGGATCCTACCAGCATCTGCAGGAAGGCCAGGAGGCTGGCAG
GAAGGCAGGCTGAGCTGTGCCAGGCGGAGCCGGAAGTAGTGGCAGAGCTTGCCCGGGGCGCAAG
ACTGGGGGTTCGAGAATGTCAGTTCCAGTTCCGTTTCCGACGCTGGAACTGCTCCAGTCACAGC
AAGGCCTTTGGGCGCGTCCTGCAGCAGGACATTCGAGAGACAGCTTTTGTGTTTGCAATTACCG
CTGCGGGTGCCAGTCACGCGGTCACTCAGGCCTGTTCCATGGGAGAGCTCCTACAGTGTGGTTG
TCAGGCACCCCGCGGGCGCGCACCGCCTAGGCCCTCCGGCCTTCTGGGCACTCCTGGACCTCCG
GGACCAACTGGCTCTCCAGATGCCAGCGCAGCCTGGGAGTGGGGAGGCTGCGGAGATGATGTCG
ACTTTGGGGATGAGAAGTCAAGACTCTTTATGGATGCACAGCACAAGCGGGGACGTGGAGATAT
CCGTGCTTTGGTGCAACTGCATAACAACGAGGCAGGCAGACTGGCGGTGCGGAGCCACACGCGC
ACCGAGTGTAAGTGCCATGGGCTTTCGGGTTCCTGTGCTCTGCGCACCTGCTGGCAGAAGCTGC
CACCGTTCCGCGAGGTGGGCGCACGGCTGCTGGAGCGCTTCCACGGCGCCTCACGCGTCATGGG
CACCAACGACGGCAAAGCTCTGTTGCCTGCGGTCCGCACCCTCAAGCCTCCCGGCCGAGCCGAT
CTCCTCTACGCAGCCGATTCACCCGACTTCTGCGCCCCCAACCGGCGCACCGGTTCACCGGGCA
CGCGCGGCCGCGCCTGCAACAGCAGTGCCCCGGACCTTAGCGGCTGCGACCTGTTGTGCTGCGG
TCGCGGACACCGCCAGGAGAGCGTACAGCTCGAGGAGAACTGCCTGTGCCGCTTCCACTGGTGC
TGCGTGGTGCAATGCCACCGCTGCCGCGTGCGCAAGGAGCTCAGCCTGTGCCTCTGACTCGCCA
CTGGTCTTGGAACTGCTTGCATTCAATTTGCAGGACTACTAGATTCCAGCAGGGGGCACTGTCT
GTGTCCAGCAGCTCCCTAGGAAAAGTACCTATTAGGCCTTGGGAAATTACAGGGGCCAGACAGG
AACTTGGGGTTTACACCAGCTCAAGAAAGCCGGGGTGGGGGGGCATACCCCTCCAGCATTCCCC
AGAAAGGCCCTCTGCTACTTTCTGCAGGAGACTAAGCAGGATCTCCCTCCCTTTGGCCTTCCAG
ATGGAAATAAAAAAGCCAGACTCTGGCCTCCAGAAATAGTACTCCTCAGAATTACTGGGGTGGA
TGGGTGAGTTTAGTATTAATAAAGACATTTAAATCCACAGTTTGAGAGGAAGTTGGGATAGGAT
AGAGGGTCAGGATATGGTGGCCCCGGTAGAGTTAGCGTTTCATTCTGAGACTATCTCATTCCAC
CGGTTACCAAGGCAGAAAGGAGTGAGGGAGGAATTGTGGAAAGACAGAACGGGGTGAGGAAACC
TCGCATCCCTCCTTTAGCCCTTTTTGTTCTTTCTTGACTCTTGAGAACATGTCCCATTTTAAAG
GGTCACAAAGAGCCCAGAAGTTTCTAGTAGTGTGCTTAGTTCTCAGGCCTTTGTGTTAATTCTT
CGGGCATTATGTCTGTTTCAGCGACTTTTGAAGAAATTAAAGGTCATGAGATTAAAAGCTCGCC
ATAAACTGTAAAATA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001101696	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL75370	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001101696 ⟸ NM_001108226
- Peptide Label:	precursor
- UniProtKB:	D4A3W9 (UniProtKB/TrEMBL), A6JVW2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLPPVPSCLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAE LARGARLGVRECQFQFRFRRWNCSSHSKAFGRVLQQDIRETAFVFAITAAGASHAVTQACSMGE LLQCGCQAPRGRAPPRPSGLLGTPGPPGPTGSPDASAAWEWGGCGDDVDFGDEKSRLFMDAQHK RGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHG ASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGC DLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL hide sequence

RefSeq Acc Id:

ENSRNOP00000023439 ⟸ ENSRNOT00000023439

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A3W9-F1-model_v2	AlphaFold	D4A3W9	1-365	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304559	AgrOrtholog
BioCyc Gene	G2FUF-27116	BioCyc
Ensembl Genes	ENSRNOG00000017409	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000023439	ENTREZGENE
	ENSRNOP00000023439.6	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000023439	ENTREZGENE
	ENSRNOT00000023439.7	UniProtKB/TrEMBL
Gene3D-CATH	3.30.2460.20	UniProtKB/TrEMBL
InterPro	Wnt6	UniProtKB/TrEMBL
	Wnt_C	UniProtKB/TrEMBL
	Wnt_grthfactor_CS	UniProtKB/TrEMBL
	Wnt_SF	UniProtKB/TrEMBL
KEGG Report	rno:316526	UniProtKB/TrEMBL
NCBI Gene	316526	ENTREZGENE
PANTHER	PROTEIN WNT-6	UniProtKB/TrEMBL
	Wnt	UniProtKB/TrEMBL
Pfam	wnt	UniProtKB/TrEMBL
PhenoGen	Wnt6	PhenoGen
PRINTS	WNT6PROTEIN	UniProtKB/TrEMBL
	WNTPROTEIN	UniProtKB/TrEMBL
PROSITE	WNT1	UniProtKB/TrEMBL
SMART	WNT1	UniProtKB/TrEMBL
UniProt	A6JVW2	ENTREZGENE, UniProtKB/TrEMBL
	D4A3W9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-29	Wnt6	Wnt family member 6	Wnt6	wingless-type MMTV integration site family, member 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-14	Wnt6	wingless-type MMTV integration site family, member 6	Wnt6	wingless-related MMTV integration site 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Wnt6	wingless-related MMTV integration site 6	Wnt6_predicted	wingless-related MMTV integration site 6 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Wnt6_predicted	wingless-related MMTV integration site 6 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)